Handbook For Newly Qualified Cas.pdf

Committee for Members in Industry and Business (CMI&B) THE INSTITUTE OF CHARTERED ACCOUNTANTS OF INDIA (Set up by an Act of Parliament)

The Institute of Chartered Accountants of India

2

Message &RQJUDWXODWLRQWRDOO1HZO\4XDOL¿HG&KDUWHUHG Accountants! To become a Chartered Accountant, one requires a lot of hard work, efforts and strong determination. Success introduces the Newly Qualified Chartered Accountants (NQCAs) to the world of employment and other professional opportunities. To lead life as a true professional, commitment to stakeholders as well as strict adherence to Chartered Accountants’ code of conduct mattered more. So, let us pledge, whether one be in practice, employment or entrepreneurship, ethics must prevail and precede other professional priorities. As society expects more from professionals, so our focus should be on accuracy in every action that we perform. The WZROHWWHUZRUGµ&$¶VLJQL¿HVV\PERORIWUXVWDQGZHQHHG to maintain so all through. The preference of corporations for NQCAs is all due to the fact that besides being theoretically sound, they are also blessed with certain ethically sound HABIT (Honesty, Accountability, Benchmark, Integrity and Transparency). At the same time sharper focus on progressive improvement in communication and presentation skills as well as have greater awareness about ever changing world economic environment is the key to success in campus placements. So, appear in campus interview with due SUHSDUDWLRQWRIXO¿OOUHTXLUHPHQWVRIUHVSHFWLYHFRPSDQLHV

CA. Naveen N. D. Gupta President, ICAI

CA. Prafulla Chhajed Vice-President, ICAI

CA. Dhiraj Kumar Khandelwal Chairman, CMI&B of ICAI

The Committee for Members in Industry & Business &0, % RI,&$,KDVPDGHDQHɣRUWWRKHOSWKHFDQGLGDWHV by bringing this e-booklet that will mainly cover such areas as are commonly touched upon by interviewers. We are sure this e-booklet will help in your preparation for the forthcoming campus interview. Wish you all a good luck in upcoming Campus.

CA. Rajesh Sharma Vice-Chairman, CMI&B of ICAI

3

CONTENTS Section I Introduction & Brief Overview ........................................................................................ 7 •

Brief about ICAI ........................................................................................................ 7

•

Objectives of CMI&B ................................................................................................ 7

‡

([SHFWDWLRQRIUHFUXLWHUVIURPQHZO\TXDOL¿HG&$V ...............................................8

•

How CAs ensure industrial growth and sustainable development ........................8

•

Career options in Industry .......................................................................................9

•

Interview Preparation ............................................................................................. 10

‡

&RPSDQLHV3UR¿OH3DUWLFLSDWLQJLQ&DPSXV$XJXVW6HSWHPEHU .................11

Section II Personality to Succeed ....................................................................................................51 •

Good Grooming....................................................................................................... 53

•

Communication Skills ............................................................................................. 56

Section III How to Succeed in a Group Discussion ........................................................................ 61 Section IV Facing the Interview .......................................................................................................71 •

Preparing Yourself for an Interview ......................................................................

•

What the Interviewer checks in an interviewee .................................................... 76

•

Common Interview Questions ................................................................................78

Section V Preparing a Resume .......................................................................................................85

4

Section I Introduction & Brief Overview In this section... 1.

Brief about ICAI

 2EMHFWLYHVRI&0, %  ([SHFWDWLRQRIUHFUXLWHUVIURPQHZO\TXDOL¿HG&$V 4.

How CAs ensure industrial growth and sustainable development

5.

Career options in Industry

6.

Preparation for Interviews

 &RPSDQLHV3UR¿OH3DUWLFLSDWLQJLQ&DPSXV$XJXVW6HSWHPEHU

5

The Institute of Chartered Accountants of India

³$ULVH$ZDNH$QGVWRSQRWXQWLOWKH JRDOLVUHDFKHG´ – Swami Vivekanand “Learning gives creativity, creativity OHDGVWRWKLQNLQJWKLQNLQJSURYLGHV NQRZOHGJHNQRZOHGJH PDNHV\RXJUHDW´ – A. P. J. Abdul Kalam ³&RQ¿GHQFHDQGKDUGZRUNLVWKHEHVW PHGLFLQHWRNLOOWKHGLVHDVHFDOOHG failure. It will make you a successful SHUVRQ´ – A. P. J. Abdul Kalam

6

How to face an Interview Board

Introduction & Brief Overview Brief about ICAI The Institute of Chartered Accountants of India (ICAI), established 68 years ago, by an Act of Indian Parliament, continues its operation as the single largest statutory accounting body of the world. ICAI stands on four pillars – Regulator, Standard Setter, Educator and Partner in Nation Building and has been functioning under the DGPLQLVWUDWLYHFRQWURORIWKH0LQLVWU\RI&RUSRUDWH$ɣDLUV0&$ RIWKH*RYHUQPHQW of India, as an extended arm. In short, Independence, Integrity and Excellence remain the core values of ICAI. ICAI enjoys the privilege of being the founder members of the International Federation of Accountants (IFAC), International Accounting Standard Board (IASB), South Asian Federation of Accountants (SAFA) and Confederation of Asia Pacific Accountants (CAPA). Again, ICAI is the first Professional body in the country which has been nominated by the Hon’ble Prime Minister of India to take the Swachh Bharat Abhiyaan forward. Objective of CMI&B Maintaining strong and spontaneous relationship with the industry and other business houses remains the main focus of the Committee for Members in Industry & Business (CMI&B) of the Institute of Chartered Accountants of India (ICAI). An initiative in that effect remains the Campus Placement Programme (held twice a year) that SURYLGHVDSODWIRUPWRERWKWKH1HZO\4XDOL¿HG&KDUWHUHG$FFRXQWDQWV14&$V DQG WKHRUJDQL]DWLRQVORRNLQJIRUWRKLUHWKHEHVWDYDLODEOHWDOHQWVWRIXO¿OOWKHLU+XPDQ Resource requirement. ICAI simply acts as a facilitator to bring the recruiter and NQCAs together.

7

The Institute of Chartered Accountants of India ([SHFWDWLRQ RI UHFUXLWHUV IURP QHZO\ TXDOL¿HG &$V The CA professionals are believed to be highly skilled, combined with commercial acumen and awareness, and well informed citizens of the world as they are supposed WRFRQWLQXDOO\XSGDWHDQGXSJUDGHWKHLUVNLOOVHWVWRUHPDLQUHOHYDQWDQGHɣHFWLYHLQ their role. The complexities of commerce in a global economy are constantly changing and it requires the CAs to maintain the highest degree of professional and personal integrity as ethical requirements are also increasing. The following range of competencies and skills are typical and usually sought-after E\WKHUHFUXLWHUVZLWKDQH[SHFWDWLRQWKDWVXFKDWWULEXWHVZLOOWUDQVODWHLQWRHɣHFWLYH SHUIRUPDQFHDQGHɤFLHQWIXQFWLRQLQJRIWKHQHZUHFUXLWVLQWKHLUFKRVHQ¿HOG ‡

$SDVVLRQIRU¿QDQFHZLWKDQLQWHUHVWDQGDELOLW\WRZRUNZLWK¿JXUHV

•

Commercial awareness with an interest in business including knowledge of any current political/legislative/financial issues that may have an impact on your FKRVHQ¿HOG

•

Communication and inter-personal skills with ability to communicate complex information clearly and to build relationships with others at all levels within the business

•

Ability to demonstrate evidence of team working

•

The stamina and commitment to work for long hours

•

Presentation skills, report writing and attention to detail

•

Leadership and negotiation skills

•

Problem-solving and analytical skills

Having transferable work experience in the chosen sector is crucial and that in turn, will ensure you are going to enjoy the work and culture of the organization into which you are ultimately recruited. Organizations are also keen to understand your PRWLYDWLRQHLWKHUIRUDSSO\LQJWRDFFRXQWDQF\DQG\RXULQWHUHVWLQ¿QDQFHDQGEXVLQHVV or readiness to join at locations of their choice. Questions are usually asked based on and closely related to the skills and attributes that you mentioned in the application IRUPVSUR¿OHRQWKHSRUWDO How CAs ensure industrial growth and sustainable development The profession of CA is concerned with adding value to economies. 7KH&$VZRUNLQJVZLWKLQRUJDQL]DWLRQVWHQGWRIRFXVPRUHRQ¿QDQFLDOIXWXUHVDQG stability of that organization. This might involve work such as forecasting, preparing 8

How to face an Interview Board ¿QDQFLDOVWDWHPHQWVVRWKHEXVLQHVVFDQPDNH¿QDQFLDOO\LQIRUPHGGHFLVLRQVDXGLWLQJ internal systems to improve the many processes that impact on major corporate costs, advising on improving business performance, providing input on strategic planning, SURYLGLQJ¿QDQFLDODGYLFHWRYDULRXVPDQDJHPHQWIXQFWLRQVDQGHQJDJLQJZLWKPXOWL disciplinary projects that require financial planning. Cost reduction and control FRQWULEXWHVODUJHO\WRSURGXFWLYLW\DQGSUR¿WDELOLW\&RQVLVWHQWJURZWKZLWKHWKLFDO behaviour leads to sustainable development Career paths available for Chartered Accountants 1. Practice - To aim for a career path to Director/Partner of leading CA Firms  Join Industry/Public Sector - May join the industry . 3.

Entrepreurship 7KHTXDOL¿HG&KDUWHUHG$FFRXQWDQWVKDYLQJDQHQWUHSUHQHXULDO aptitude can initiate setting up their own business.

Career options in Industry “There exist limitless opportunities in every industry. Where there is an open mind, there will always be a frontier”- Charles F. Kettering $VDQHZO\TXDOL¿HG&$\RXQHHGWRPDNHDQLQIRUPHGFKRLFHDQGGHFLGH\RXUQH[W career move to a sector that suits you the most. The economic activities undertaken by industries, commercial houses, Public Enterprises and Not-for-Profit (NPO) RUJDQL]DWLRQVKDYHEHHQFRQYHQLHQWO\ELIXUFDWHGLQWRWZREURDGFDWHJRULHVDVEHORZ Banking & Financial Services

• • • • • • •

SECTORS COVERED: Asset management Commodities Corporate banking Hedge funds Investment banking Private equity Retail banking

• • • • • • • • • •

Commerce, Industry & Professional Services SECTORS COVERED: Retail and FMCG Chemical and pharmaceutical Technology/media/telecoms Energy and utilities Legal, professional and business services Construction, infrastructure and real estates Manufacturing Transport and distribution Health care, hospitality and tourism Education Industry 9

The Institute of Chartered Accountants of India Interview A Campus Interview, in simpler terms, implies - a short spell of interaction between the interviewee and interviewer(s) that facilitates apparent assessment of the former’s three essential attributes such as appearance, qualities and attitude besides ascertaining WKHVXLWDELOLW\RIKLVKHUFDUHHUSUR¿OHDQGFUHGHQWLDOVVSHOWLQWKHDSSOLFDWLRQIRUP for the intended job. The quote - “you will never get a second chance to build your ¿UVWLPSUHVVLRQ´VSHDNVYROXPHWRFRPSUHKHQVLYHO\GH¿QHKRZWRIDFHDQLQWHUYLHZ FRPIRUWDEO\DQGFRQ¿GHQWO\7KHLQWHUYLHZVXFFHVVODUJHO\GHSHQGVRQ\RXUSUHSDUDWLRQ (commercial acumen and awareness), presentation (how do you present yourself before the Board) and personality (art of communication). Being a fresher, the recruiter may SUHIHUWRWHVWPRVWO\WKHFDQGLGDWH¶VDSWQHVVRIDFDGHPHÀDYRXUDQGÀDLUWKDQSUDFWLFDO exposure. Lack of proper preparation not only risk chances of failure but also cause DFUDFNRQFRQ¿GHQFHOHYHOWRIDFHVRODWHU1RWKLQJLVQHZWKDWDIHZZLOOIHHOZHHN lack attention and experience tension. Remember, less is the level of fear more could be the chances of becoming winner. So be fearless and face it boldly and brilliantly; ‘luck favours the strong’. Interview Preparation The prerequisite of gaining technical knowledge, professional skills and practical experience to become a CA helped you to develop in depth understanding across accountancy, business and finance. Moreover, the CA qualification improves your ability in certain key areas such as, communication, problem solving, decision making, team working, and technical skill, compliance, adding value, conviction and ethics. It is quite likely those attributes would help you immensely to remain calm and face the interview quietly. Preparation is the first essential step forward towards a successful interview. It is important to ensure complete understanding of the company you are going to see. It is essential to conduct thorough research. Look out for all the relevant additional information including newsworthy items. Keep up to date with current market issues by reading publications such as the economic times and other business dailies. Prepare the questions you will ask during the interview. The employer will try to determine through questioning if you have the potentials necessary to do the job. The interviewer could ask you a few questions about anything you have written in your CV. This means you have to know the details surrounding every responsibility, project, course intended - anything that you have put down on your CV.

10

How to face an Interview Board

&RPSDQLHV3UR¿OH3DUWLFLSDWLQJLQ Campus August-September 2018 Company Name

Entity

6KRUW3UR¿OH

Accenture Solutions Pvt. Ltd.

Corporate

Accenture solves our clients’ toughest challenges by providing unmatched services in strategy, consulting, digital, technology and operations. We partner with more than three-quarters of the Fortune Global 500, driving innovation to improve the way the world works and lives. With expertise across more than 40 industries and all business functions, we deliver transformational outcomes for a demanding new digital world.

Ashok Leyland Ltd.

Corporate

$VKRN/H\ODQGÀDJVKLSRIWKH+LQGXMDJURXSLVWKH QGODUJHVWPDQXIDFWXUHURIFRPPHUFLDOYHKLFOHVLQ India, the 4th largest manufacturer of buses in the ZRUOGDQGWKHWKODUJHVWPDQXIDFWXUHUVRIWUXFNV $ 86   ELOOLRQ FRPSDQ\ DQG D IRRWSULQW WKDW extends across 50 countries, we are one of the most fully-integrated manufacturing companies this side of the globe. Pioneers in the Commercial Vehicle (CV) space, many product concepts have become industry benchmarks and norms. The Company’s wide-spread customer base is served through an all-India sales and service network, supplemented by close to 3000 touch points. People, Planet and Profit for all stakeholders especially our customers is at the core of Ashok Leyland which resonates with our Philosophy of ‘AAPKI JEET, HAMARI JEET’.

Axis Bank Ltd.

Corporate

Incorporated in 1994, Axis Bank has emerged as one of India’s most trusted banks and the third largest LQWKHSULYDWHVHFWRU,WLVDPRQJWKHFRXQWU\¶V¿UVW QHZJHQHUDWLRQSULYDWHVHFWRUEDQNVDQGRɣHUVWKH entire spectrum of financial services to customer segments, spanning large and mid-corporates, SME and retail businesses. With its 3,589 domestic 11

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH branches (including extension counters) and 13,977 $70VDFURVVWKHFRXQWU\DVRQVW'HFHPEHU the network of Axis Bank spreads across 1,946 cities and towns, enabling the Bank to reach out to a large cross-section of customers with an array of products DQGVHUYLFHV7KH%DQNDOVRKDVWHQRYHUVHDVRɤFHV with branches at Singapore, Hong Kong, Dubai (at the DIFC), Shanghai and Colombo; representative RɤFHVDW'XEDL$EX'KDEL'KDNDDQG6KDUMDKDQG an overseas subsidiary at London, UK.

Bajaj Allianz Life Insurance Co. Ltd.

Corporate

Bajaj Allianz Life Insurance Company Limited is one of India’s leading private life insurance companies. It is a joint venture between Bajaj Finserv Limited, the holding company for the businesses dealing with financial services of the Bajaj Group, and Allianz SE, the world’s leading insurance conglomerate and one of the largest asset managers in the world. Bajaj Allianz Life Insurance Company Limited EHJDQ LWV RSHUDWLRQV LQ  DQG WRGD\ KDV D pan-India presence with 633 branches as on 30th -XQH  7KH FRPSDQ\ RIIHUV OLIH LQVXUDQFH solutions through its strong product portfolio, which includes traditional insurance products and ULIPs for enabling customers fulfil their Life Goals. The company also offers group insurance and health insurance plans.

Bharat Electronics Limited

Corporate

In 1954, in a newly independent India, the need was utmost to develop indigenous industry. The dream of a self-reliant India gave birth to many Public Sector Undertakings. Bharat Electronics Limited (BEL) was one such dream, which has come a long way since then with the far-sighted vision of its pioneers, the dedication and hard work of its employees, support and faith of its customers and the Government of India. The Government’s clarion call for ‘Make in India’ resonates with what BEL has been successfully doing for over 6 decades.

12

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH From humble beginnings in 1954, when BEL was set up in association with CSF, France (now, Thales), to manufacture basic communication equipment, BEL now produces a wide range of state-of-the-art HTXLSPHQWLQ¿HOGVVXFKDV'HIHQFH&RPPXQLFDWLRQ Radars, Naval Systems, C4I Systems, Weapon Systems, Homeland Security, Telecom & Broadcast Systems, Electronic Warfare, Tank Electronics, Electro Optics, Professional Electronic Components and Solar Photovoltaic Systems, BEL also provides turnkey system solutions. Civilian products from BEL include Electronic Voting Machines, Tablet PC, solar-powered traffic signal systems and Access Control Systems. Starting from a single Unit in Jalahalli, Bangalore, BEL has established its presence across the country by setting up eight other Units – in Ghaziabad, Pune, Machilipatnam, Panchkula, Kotdwara, Navi Mumbai, Chennai and Hyderabad. Each Unit has a specific product mix and customer focus. BEL has also set up a wide QHWZRUNRIRɤFHVDQGVHUYLFHFHQWUHVFRXQWU\ZLGH as well as two overseas offices – at New York and Singapore. BEL was established to meet the specialized electronic equipment requirements of the Indian Defence Services. While this continues WREHLWVSULPHIRFXVWKH&RPSDQ\KDVDVLJQL¿FDQW presence in the civilian market, too. BEL exports some of its products and services to a number of countries as well. BEL has been laying great emphasis on Research and Development right from the early years. It has also been able to successfully partner as production agency with many DRDO labs. From a meagre turnover of `  ODNKV LQ 1956-57, BEL has grown manifold to record a turnover of `  FURUHV SURYLVLRQDO  LQ  16. BEL is not only a successful business story but

13

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH also an organization which cares for people and society. Even before the term ‘Corporate Social Responsibility’ gained currency, BEL has undertaken innumerable CSR activities and continues to do them with a lot of passion and commitment. BEL has set up educational institutions, including a special school for the mentally challenged. It has also set up KRVSLWDOV¿QHDUWVFOXEVDQGVSRUWVIDFLOLWLHV7KHVH and other welfare initiatives ensure a good quality of life for employees and their dependents. Some of these facilities also serve the local community. BEL is currently concentrating on promoting education, sanitation, health care, rural development, employment and enhancing vocational skills, while ensuring environmental sustainability. ‘Clean and green’ is true of every Unit of BEL. Concern for the environment is visible in the profuse greenery in all the Units. Afforestation, effluent treatment, used water recycling, generation and use of bio gas, rainwater harvesting, green buildings, setting up and using wind energy and solar energy power plants, to name a few, are some of the activities in this direction. Awards galore have come BEL’s way, recognizing its emphasis on excellence. Recent accolades include India Today PSU Awards for ‘Best Global Presence Award’, ‘Eco Friendly Award’ and ‘Best R&D Innovation Award; Digital India PSE of the Year Award; Standing Conference of Public Enterprises (SCOPE) Meritorious Award (Gold Trophy) for HR Excellence for Best Practices in Human Resource Management; Mentor Graphics Silicon India Leadership Award for ‘Best VLSI/ Embedded Design in Defence/Aerospace Sector’; International Aerospace Award for ‘Innovation’; SAP Award for Customer Excellence; SODET Gold Award for ‘Technology Innovation’; Government of Karnataka ‘State Export Ex

14

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

Bharat Petroleum Corpn. Limited

Corporate

Bharat Petroleum Corporation Limited, a Maharatna Public Sector Undertaking, engaged in exploration and refining of petroleum products. It is an integrated energy major creating value across the energy chain owning some India’s most trusted brands such as MAK, Bharat Gas, Speed etc. We are looking for talented individuals who wish to take their career to soaring heights.

BSR & Co LLP

Bundl Technologies Private Limited

Firm of BSR & CO LLP An independent audit of financial Chartered statements is essential for the effective operation Accountants of business entities and the capital markets. We are committed to providing a constructive and challenging audit, one that is also independent and delivers the messages that matter to management and the audit committee. We add value beyond the financial statement through the insights we bring, based on our knowledge of a client’s business drivers and of individual sectors. Apart from financial statements audit (including IFRS and US GAAP reporting), we also provide other forms of assurance and attestation reporting. Our approach is based on robust audit methodologies, appropriate use of technology and a wide range of compliance tools underpinned by sound judgment and objectivity. Corporate

• Swiggy is India’s leading food ordering and delivery SODWIRUP ‡ 6WDUWHG LQ $XJ  E\ 6KUL +DUVKD Majety, Nandan Reddy & Rahul J • We have recently UDLVHG0LOOLRQLQRXUVHULHV*URXQGRIIXQGLQJ from Naspers and with this, we have joined the billion-dollar start-up unicorn club • In a short VSDQ RI MXVW  \HDUV ZH KDYH JRQH IURP MXVW  neighbourhoods in the country to 15 locations PAN ,QGLDDQGH[SDQGLQJE\6HSZHZLOOEHSUHVHQW LQFLWLHV%DQJDORUH&KHQQDL+\GHUDEDG3XQH

15

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH Mumbai, Kolkata, Delhi-NCR, Jaipur, Chandigarh, Ahmedabad, Lucknow, Nagpur, Coimbatore, Kochi, Noida • With over 35,000 restaurant partners and RYHUGHOLYHU\H[HFXWLYHVZHDUHUHGH¿QLQJ the hyperlocal ecosystem of the country• Current KHDGFRXQW ±  HPSOR\HHV 3$1 ,QGLD ‡ 7KH technology that powers the Swiggy app to give consumers a seamless ordering and delivery experience, is completely developed in-house ‡ 6ZLJJ\ FXOWXUH 2SHQ GHVN SROLF\ IOH[LEOH ZRUN culture, values at the core of what we do, young and vibrant work environment • Constant innovation is key to Swiggy’s success so far • Swiggy is also into 1HZ6XSSO\EXVLQHVVZKHUHLQLWUXQV6ZLJJ\ owned Kitchens in Bangalore and expanding to other cities (Hyderabad/Chennai, Mumbai. Etc.,) The motive is to bridge the gap between the servers and consumers • We are planning to start up a new vertical which is still in the initial stage of planning called DASH

Capgemini Business services

16

Corporate

A global leader in consulting, technology services and digital transformation, Capgemini is at the forefront of innovation to address the entire breadth of clients’ opportunities in the evolving world of cloud, digital and platforms. Building on its VWURQJ\HDUKHULWDJHDQGGHHSLQGXVWU\VSHFL¿F expertise, Capgemini enables organizations to realize their business ambitions through an array of services from strategy to operations. Capgemini is driven by the conviction that the business value of technology comes from and through people. ,W LV D PXOWLFXOWXUDO FRPSDQ\ RI  WHDP members in over 40 countries. The Group UHSRUWHGJOREDOUHYHQXHVRI(85ELOOLRQ

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

Craftsman Automation Limited

Corporate

We are an engineering industry having turnover around 1,500 crore, catering to various segments like automotive, Gears & Transmission, Heavy Parts, Foundry, Sheet-metal Equipment, Engineering Components & Assembly. Our products are VSTORE™ Automated Storage and Retrieval System, Craftsman Storage, Craftsman Marine, Mould Base, Tool Room, Special Purpose Machine. We have LQGXVWULDOXQLWVLQWKHIROORZLQJORFDWLRQV 1. Coimbatore, Tamil Nadu 6ULSHUXPEXGXU7DPLO1DGX 3. Bengaluru, Karnataka 4. Pithampur, Madhya Pradesh 5. Jamshedpur, Jharkhand 6. Pune, Maharasthra 7. Faridabad, Haryana

Dell International Services India Pvt. Ltd.

Corporate

Dell Technologies Inc. is an American multinational information technology corporation based in Round Rock, Texas. It was formed as a result of the acquisition of Dell and EMC Corporation.

Deloitte Firm of In India, Deloitte offers a range of Audit, Risk Haskins & Sells Chartered Advisory, Tax, Consulting and Financial Advisory LLP Accountants services across thirteen cities. Our existence for over a century in the professional arena supplements WKHWHFKQLFDOSUR¿FLHQF\RIWKHFOLHQWVHUYLFHWHDPV to create powerful business solutions tailored to the client’s need. We focus on clients. We take pride in our ability to provide. quality services— whether they are an owner-managed business or a large multinational corporation. We are a multiVNLOOHGPXOWLGLVFLSOLQHG¿UPRɣHULQJFOLHQWVDZLGH range of industry-focused business solutions. We recruit the brightest and the best—whatever their VSHFLDOL]DWLRQ:HFRPELQHWKHG\QDPLVPDQGÀXLG thinking of the young graduate, with the business knowledge and insight of the seasoned executive. 17

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH Investing in our people means our clients get world-class expertise to solve their complex business problems

Eisner Amper India Consultants Pvt. Ltd.

18

Corporate

Eisner Amper (India) Consultants Private Limited (Eisner Amper India) is a wholly owned subsidiary of Eisner Amper LLP (Eisner Amper). Eisner Amper LLP started their India operations 11 years EDFN LQ  LQ 0XPEDL DQG  \HDUV EDFN LQ Bangalore. EisnerAmper is ranked among the top 15 accounting firms in the United States. We are PCAOB - registered and as an independent member of Allinial Global, we service clients worldwide. EisnerAmper is one of the largest accounting firms in the US with nearly 1,800 employees and 180 partners. EisnerAmper provides audit, tax, internal audit, pension audit, and a variety of other accounting, tax and consulting services to clients in the US and worldwide. EisnerAmper is headquartered in New York, and has offices in New Jersey, Philadelphia, California, Cayman Islands, Connecticut, Massachusetts, Florida, Texas, ,VUDHO0XPEDLDQG%DQJDORUH(LVQHU$PSHURɣHUV responsive accounting, consulting and tax services with an entrepreneurial focus, providing clients with smart, analytical insights delivered in an DSSURDFKDEOHVW\OH2XUDFFRXQWLQJ¿UPZRUNVZLWK enterprises as diverse as sophisticated financial institutions and start-ups, global public companies and middle-market companies; as well as high QHWZRUWKLQGLYLGXDOVIDPLO\RɤFHVQRWIRUSUR¿W organizations, and entrepreneurial ventures across a variety of industries. Recognized internationally as one of the premier firms providing advisory, DXGLWDQGWD[VHUYLFHVWR¿QDQFLDOVHUYLFHVHQWLWLHV and portfolio companies, Eisner Amper serves more than 1,300 hedge funds, 1000 private equity and Venture Capital funds, real-estate funds and other investment funds. The firm works with

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH nearly 100 broker/dealers serving investment banks and retail brokerages. Eisner Amper LLP ZDV QDPHG %HVW $FFRXQWLQJ )LUP LQ WKH  Service Provider Awards survey conducted for Hedgeweek Global. Announced in London, these prestigious awards are based on a rigorous peer review survey of Hedgeweek’s readers, which includes a global audience of investors, fund managers and industry service providers. Eisner Amper India’s team based in Mumbai provides audit and tax services to Eisner Amper’s clients in the financial services industry (Hedge Funds, Private Equity Funds, Venture Capital Funds, Real Estate Funds, Broker-Dealers and Registered Investment Advisors). We are looking to hire highly motivated individuals with strong technical audit skills to expand our Financial Services audit team.

Evolutionary Systems Private Ltd.

Corporate

Evosys, an Oracle Platinum Partner with 11 years’ experience, focuses exclusively on Oracle Cloud implementation and consultancy to cater to the needs of a market which demands high-quality, future-proof solutions. One of the top, fastest-growing Oracle Cloud partners, with customers who have adopted all Oracle SaaS solutions including ERP, HCM, SCM, CRM, Hyperion (PBCS), BI and PaaS. We are a processcentric organization that believes in specialized solutions and have demonstrated an exceptional UHFRUGLQLPSOHPHQWDWLRQIRUGLɣHUHQWYHUWLFDOVOLNH Healthcare, Finance, Logistics, Manufacturing, and Distribution across public and private sectors. Evosys is experiencing tremendous growth and is expanding its global operation. Already present in 19 countries including North America, Europe, the Middle East, Australia and Asia. To accommodate such fast-paced growth, Evosys have also expanded their capacity to H[HFXWHRYHUSURMHFWVVLPXOWDQHRXVO\ZLWKD dedicated Oracle Center of Excellence, host to over 1000 experienced Oracle consultants. 19

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH

Exide Life Insurance Company Limited

Corporate

Exide Life Insurance Company Limited, an HVWDEOLVKHGDQGSUR¿WDEOHOLIHLQVXUDQFHFRPSDQ\ FRPPHQFHG RSHUDWLRQV LQ  DQG LV headquartered in Bengaluru. The Company is 100% owned by Exide Industries Limited. The company serves over 15 lakh customers and manages assets of over `FURUH'XULQJWKH¿QDQFLDO\HDU 18, the Company achieved Total Premium Income of over ` FURUHDQGGHOLYHUHG`FURUHLQ3UR¿WV (PBT). Exide Life Insurance distributes its products through multi-channels viz. Agency, Banc assurance, Corporate Agency & Broking, direct as well as online. 7KH$JHQF\FKDQQHOFRPSULVHVRIDGYLVRUV ZKR DUH DWWDFKHG WR RYHU  FRPSDQ\ RIILFHV DFURVVWKHFRXQWU\7KHFRPSDQ\DOVRRɣHUVJURXS life insurance solutions. The company is focused on providing long term protection and savings solution plans and has a strong traditional product portfolio with a consistent bonus track record. The FRPSDQ\ KDV ,62  TXDOLW\ FHUWLILFDWLRQ for all Customer Service processes and the ISO/IEC IRULQIRUPDWLRQVHFXULW\PDQDJHPHQW

Futures First Info Services Private Limited

Corporate

Futures First offers a unique opportunity in India to work in the world’s most stimulating, liquid, and well-developed derivatives markets. This is an exciting challenge and an excellent opportunity for bright, analytical, highly motivated graduates to join a vibrant business and participate directly in today’s dynamic world markets.

20

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

Futures First Info Services Pvt. Ltd.

Corporate

Futures First is part of the Hertshten Group, it’s holding company, which has a fast-growing SURSULHWDU\¿QDQFHEXVLQHVVWKDWFRQWLQXHVWRUDLVH the international benchmarks for excellence across WKH¿QDQFHLQGXVWU\)XWXUHV)LUVWEHQH¿WVIURPWKH VLJQL¿FDQWLQWHUQDWLRQDOH[SHULHQFHRIWKH+HUWVKWHQ *URXSLQGHULYDWLYHVPDUNHWVDFURVVJOREDO¿QDQFLDO exchanges. Futures First has been operating in India for 14 years now and we are proud of the success it has achieved in growing operations and expanding LWVVHUYLFHVWRPDMRULQWHUQDWLRQDO¿QDQFLDOPDUNHWV Today Futures First employs the brightest and most FRPSHWLWLYHPDUNHWDQDO\VWVDFURVV¿YHEUDQFKRɤFHV in India (Bengaluru, Gurgaon, Hyderabad, Jaipur and Kolkata) and continues to recruit the best talent from the most competitive universities and institutes in India.

Galaxy Surfactants Limited

Corporate

Galaxy Surfactants Ltd. is a name well-established and recognized in the manufacturing of Performance Surfactants & Specialty Chemicals for Home and 3HUVRQDO&DUHVHJPHQWVIXO¿OOLQJQHHGVRIFOHDQLQJ health & beauty care and comfort. With humble beginning in 1980 with two products, Galaxy has today blossomed into a value based, technology driven and customer oriented organization with turnover above USD 350 Million and exports to over 103 countries having regional offices in the Netherlands, USA, Mexico, Colombia, Brazil, 7XUNH\ DQG (J\SW :H DUH ,62  ,62  ,62  ,62  RUJDQL]DWLRQ ZLWK D commitment to Safety, Health and Environment through sustainability accredited with Responsible Care Logo. Manufacturing sites are located in India in Maharashtra & Gujarat, Egypt and USA certified with RSPO. Sharing common dreams with our customers has been a constant pursuit at

21

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH Galaxy. By understanding and fulfilling the needs and requirements of our customers, we have truly become a Global Supplier to Global Brands. Galaxy ¿UPO\EHOLHYHVRQWKHVWUHQJWKRILWVSHRSOHZKHUH Human Resource Development is working as People Energy Function and considers its people as a major competence to drive the growth. The prime emphasis at Galaxy is on fundamental research and the creation of new molecules through structured innovation funnel strategy. Our quest for excellence and our innate competitive nature has propelled us to embrace Total Productive Maintenance (TPM) across the organization. Galaxy is been bestowed by various excellence awards and recognitions. *DOD[\ KDYLQJ GHYHORSHG RYHU  SURGXFWV ZLWK  SURGXFW PROHFXOHV DQG VROXWLRQV SDWHQWHG under USA patents and it has reached the crest of industry owing to its mastery over the field of specialty chemicals. Today we offer wide range of products to Detergents, Cosmetics, Soaps, Shampoos, Conditioners and Flavors & Fragrance Industries which include Surfactants, Amino Acid Surfactants, UV Absorbers, Emulsifying Agents, Ethoxylates, Betains, Alkanolamides, Preservatives, Fatty Acid Esters, Polyquats, Preservatives Blends, Ready Mix & Pearlising Blends, Proteins & Protein Hydrolates etc. Galaxy implemented best manufacturing practices and hence enjoying the global supplier status with top notch companies in the world in the field of cosmetics. Please visit us at www.galaxysurfactants. com.

22

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

Genpact India Pvt. Ltd..

Corporate

*HQSDFW1<6(* VWDQGVIRU³JHQHUDWLQJEXVLQHVV impact.” We are a global leader in digitally-powered business process management and services. We architect the Lean DigitalSM enterprise through our patented Smart Enterprise Processes (SEPSM) framework that reimagines our clients’ operating model end-to-end, including the middle and back offices. This creates Intelligent OperationsSM that we help design, transform, and run. The impact on our clients is a high return on transformation LQYHVWPHQWVWKURXJKJURZWKHɤFLHQF\DQGEXVLQHVV DJLOLW\)RUWZRGHFDGHV¿UVWDVD*HQHUDO(OHFWULF division and later as an independent company, we have been passionately serving our clients. Today, we generate impact for a few hundred strategic clients, including approximately one fifth of the )RUWXQH*OREDODQGKDYHJURZQWRRYHU SHRSOHLQFRXQWULHVZLWKNH\RɤFHVLQ1HZ
Glenmark Pharmaceuticals Ltd.

Corporate

Glenmark was founded with a vision to emerge as a leading integrated research-based, global pharmaceutical company. Over the decades, we have established ourselves as a leading player in the discovery of new molecules both NCEs (New Chemical Entity) and NBEs (New Biological Entity). We have several molecules in various stages of preclinical and clinical development and are primarily focused in the areas of Oncology, Respiratory and Dermatology. Our branded generics business has a significant presence in markets across emerging economies including India. The generics business services the requirements of developed markets like

23

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH US and Western Europe. Our API business sells products in over 80 countries including the US, various countries in the EU, South America and India. With 17 manufacturing facilities and 5 R&D centers dedicated to the goal of enriching lives across the globe we believe that the real force behind our continued successes are dedicated employees from across 50 nationalities, committed to creating ‘A new way for a new world’.

HCL Technologies Ltd.

24

Corporate

Founded in 1976 as one of India’s original IT garage start-ups, HCL is a pioneer of modern FRPSXWLQJZLWKPDQ\¿UVWVWRLWVFUHGLWLQFOXGLQJ the introduction of the 8-bit microprocessorbased computer in 1978 well before its global peers. Today, the HCL enterprise has a presence across varied sectors that include technology, healthcare and talent management solutions and comprises four companies - HCL Infosystems, HCL Technologies, HCL Healthcare and HCL TalentCare. The enterprise generates annual revenues of over US $7 billion with more than 110,000 employees from 100 nationalities operating across 31 countries, including over 500 points of presence in India. Highlights of the HCL SAP )LQDQFH3UDFWLFHDVDWHDP *OREDOWHDPRI consultants spreading across continents consisting of Chartered Accountants, CPAs and MBAs. * Industry leader in Business Tranformation VHUYLFHVRɣHULQJVLQ6$3 ,QQRYDWLRQGULYHQ¿QDQFH solutions for HCL customers in different industry verticals * Financial Solutions and analytics on latest SAP Digital Platform S/4HANA * Global solutions on Regulatory Compliances across geographies including complex tax regulations. * Compensation as per Industry standards * Fast-tracked career path with grooming from industry experts and interaction with senior leaders

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

Hero MotoCorp Ltd.

Corporate

Hero MotoCorp Ltd. - World’s Largest Two wheeler manufacturers

Hindalco Industries Limited

Corporate

Hindalco Industries Limited, metals flagship company of the Aditya Birla Group, is the industry leader in aluminium and copper. With a consolidated turnover of US$18 billion, Hindalco is the world’s largest aluminium rolling company and one of Asia’s biggest producers of primary aluminium. Its stateof-art copper facility comprises a world-class copper smelter and a fertiliser plant along with a captive jetty. The copper smelter is among the world’s largest custom smelters at a single location.

Hindustan Coca Cola Beverages Private Limited

Corporate

Hindustan Coca-Cola Beverages Pvt. Ltd., is one of India’s largest FMCG manufacturing and distribution companies. It is responsible for the manufacture, package, sale and distribution of beverages under the trademarks of The Coca-Cola Company. The &RPSDQ\ RZQV DQG RSHUDWHV  IDFWRULHV ,W DOVR sources from and supports 11 contract packers’ plants. A network of 4,000 distributors and over 1.9 million retail outlets distribute the high quality, great tasting beverages manufactured by Hindustan CocaCola Beverages.

Indian Oil Corporation Limited

Corporate

Indian Oil’s business interests straddle the entire hydrocarbon value-chain – from refining, pipeline transportation and marketing of petroleum products to exploration & production of crude oil & gas, marketing of natural gas and petrochemicals, besides forays into alternative energy and globalisation of downstream operations. Indian Oil Corporation (Indian Oil) is India’s largest commercial enterprise, with a sales turnover of `FURUHDQGSUR¿WV of `  FURUH IRU WKH \HDU  ,QGLDQ 2LO is ranked 137 among the world’s largest corporates (and first among Indian enterprises) in the prestigious Fortune ‘Global 500’ listing for the 25

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH \HDU$V,QGLD¶VÀDJVKLSQDWLRQDORLOFRPSDQ\ with a 33,000-strong work-force currently, Indian Oil has been meeting India’s energy demands for over half a century. With a corporate vision to be ‘The Energy of India’ and to become ‘A globally admired company,’ Indian Oil’s business interests straddle the entire hydrocarbon value-chain – from refining, pipeline transportation and marketing of petroleum products to exploration & production of crude oil & gas, marketing of natural gas and petrochemicals, besides forays into alternative energy and globalisation of downstream operations. Having set up subsidiaries in Sri Lanka, Mauritius and the UAE, the Corporation is simultaneously scouting for new business opportunities in the energy markets of $VLDDQG$IULFD,WKDVDOVRIRUPHGDERXWMRLQW ventures with reputed business partners from India and abroad to pursue diverse business interests.

26

Infosys Ltd.

Corporate

Infosys is a global leader in next-generation digital services and consulting. We enable clients in 45 countries to navigate their digital transformation. With over three decades of experience in managing the systems and workings of global enterprises, we expertly steer our clients through their digital journey. We do it by enabling the enterprise with an AI-powered core that helps prioritize the execution of change. We also empower the business with agile digital at scale to deliver unprecedented levels of performance and customer delight. Our always-on learning agenda drives their continuous improvement through building and transferring digital skills, expertise, and ideas from our innovation ecosystem.

ITC Limited

Corporate

ITC is one of India’s foremost private sector companies with a market capitalisation of over US$ 50 billion and Gross Sales Value (Inclusive of all taxes and net of rebates/discounts) of over

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH US$ 10 billion. Its robust portfolio of businesses encompass FMCG, Hotels, Paperboards & Specialty Papers, Packaging, Agri-Business, and Information Technology. ITC is today India’s leading FMCG marketer, the Market leader in the Paperboards and Packaging segment, a pioneer in rural transformation through its Agri Business, the world’s greenest Luxury Hotel Chain and a digital full services global player in the Information Technology segment. ITC takes pride in its ability to establish winning businesses and brands, build business leaders and create value for India. ITC is a global exemplar in sustainability. Its businesses and associated value chains have created sustainable livelihoods for around 6 million people, many of whom represent the weakest in society. ITC is the only HQWHUSULVH LQ WKH ZRUOG WR EH FDUERQ SRVLWLYH  years), water positive (15 years), and solid waste recycling positive (10 years). lTC operates a cadreised Finance function that serves all its businesses. The Finance function in ITC proactively partners the various businesses of ITC. The functional role is a dynamic amalgam of three distinct dimensions, namely, Value Strategist, Risk & Opportunity Manager and Service & Solution Provider. ITC’s multi-business context provides opportunities for working in a wide range of business environments, enabling growth through professional development.

John Deere India Private Limited

Corporate

,QWURGXFWLRQ WR -RKQ 'HHUH 'HHUH  &RPSDQ\ (www.John Deere.com) is a world leader in providing advanced products and services and is committed to the success of customers whose work is linked to the land - those who cultivate, harvest, transform, enrich and build upon the land to meet the world’s dramatically increasing need for food, fuel, shelter and infrastructure. Since its founding in 1837, John Deere has seen a great many changes in its business, 27

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH its products, and its services. Change always comes with opportunity. And Deere has always been ready and willing to embrace it. Yet, through it all, John Deere is still dedicated to those who are linked to the land – farmers and ranchers, landowners, builders, and loggers. And Deere has never outgrown, nor forgotten, its founder’s original core values. Those values determine the way John Deere works, the quality John Deere offers, and the unsurpassed treatment one gets as a customer, investor, and employee. John Deere’s business includes equipment (agriculture, lawn & garden, construction, landscaping & grounds care, golf & VSRUWVWXUIIRUHVWU\HQJLQHV GULYHWUDLQ ¿QDQFLDO FUHGLW DQG SDUWV  DIWHU VHUYLFHV ,Q  -RKQ 'HHUH UHSRUWHG  ELOORQ GROODU UHYHQXH 6LQFH ODVW  \HDUV -RKQ 'HHUH LV EHLQJ OLVWHG DPRQJ global fortune 500 companies. Also, since last many years, John Deere has been named among World’s Top 50 Most Admired Companies as per global Fortune Magazine. As per Ethisphere Institute, Deere & company is named one of World’s Most Ethical Companies for 11th consecutive year and it is among only 13 companies that have been named each year to the honor. Core values John Deere ZRUNVHYHU\GD\WRXSKROGLWVIRXQGHU¶VFRUHYDOXHV Integrity, Quality, Commitment, and Innovation. They are values John Deere’s employees’ live and breathe – values found in every product, service, and opportunity offered. John Deere India John Deere India Private Limited (www.deere.co.in) is a subsidiary of Deere & Company, USA. John Deere in India is a strong team of over 6000 employees working towards its global commitment of serving those linked to the land. John Deere believes that it is its privilege to contribute to the growing food needs across the world

28

How to face an Interview Board

Company Name Kalyaniwalla & Mistry

Entity

6KRUW3UR¿OH

Firm of Kalyaniwalla & Mistry LLP (“K&M”), Chartered Chartered Accountants, is a multi-service, multi-location, Accountants professional service organization established in WKH\HDUZLWKRIILFHVRUDVVRFLDWHVLQDOOWKH major cities in India. K&M is equipped to meet the changing demands of the corporate and noncorporate industrial, commercial and financial businesses with its resources which include more than 400 professionals and highly trained personnel ZLWKVSHFLDOL]HGVHUYLFHFDSDELOLWLHVLQGLYHUVH¿HOGV covering a wide spectrum of activities. We define our success not by size but by client satisfaction. 7KH¿UP¶VXQGHUO\LQJDLPLVWRSURYLGHDQLQWHJUDWHG service to its clients covering Audit & Assurance, Tax Compliance & Advisory, Corporate Advisory & Consultancy and Outsourcing.

KPMG Global Delivery Center

Corporate

KPMG Global Delivery Center (GDC) is an Indian Private Limited Company and subsidiary of KPMG LLP (KPMG), a United States of America (US) based limited liability partnership providing professional audit, tax and advisory services to companies headquartered or based in the US and Canada. GDC is KPMG’s global delivery platform that is an integral part of the firm’s strategy to enhance innovation, build scalability, and provide high quality Audit and Data & Analytics services to US companies by leveraging KPMG’s proprietary audit methodology and proprietary audit tools and technologies. GDC WRGD\FRPSULVHVSURIHVVLRQDOVEDVHGDFURVV Bangalore & Kochi, India.

Kribhco Fertilizers Limited

Corporate

KRIBHCO Fertilizers Ltd. (KFL), having its Corporate Office at Noida (U.P.), manufactures nitrogenous fertilizer and is a gas based modern technology Fertilizer Company. From natural gas, Ammonia and Carbon Dioxide are produced which are the feedstock for production of Urea a nitrogenous fertilizer. 29

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH Integrated Urea and Ammonia manufacturing facility at Shahjahanpur (U.P.) is located at village Piprola on 6WDWH+LJKZD\1RDQGLVDERXWNPIURPWKH district Headquarter at Shahjahanpur. The plant is in operation since Dec. 1995. KFL acquired this Ammonia Urea Fertilizer Complex from M/s. Oswal Chemicals DQG)HUWLOL]HUV2&)/ RQWK-DQ.)/ZDV UHJLVWHUHGRQ'HFXQGHUFRPSDQLHV$FW$IWHU take over, KFL management has been continuously implementing various schemes related to technology up gradation, capacity enhancement, optimization of process, infrastructural development and has already achieved significant results. The reassessed capacity of the Plant is 864,600 MTPA of urea based on M/s. Snamprogettis Ammonia stripping process technology. The Ammonia Plant capacity is 501,600 MTPA and has been set up with technology from M/s. Haldor Topsoe A.S. of Denmark. The plant has been operating at more than 100% capacity utilization since acquisition. For the )LQDQFLDO\HDUHQGHGFRPSDQ\DFKLHYHGD WXUQRYHURI5VFURUHV.)/LVDZKROO\RZQHG subsidiary of KRIBHCO, a national level cooperative society engaged in manufacturing nitrogenous and biofertilizers since 1980. KRIBHCO’s long and valuable experience in fertilizer sector provides the company the advantage of their management expertise and business know-how. The company leverages on the extensive marketing and distribution network of KRIBHCO under which the products are marketed. The plant LV,62,62DQG%62+6$6 FHUWLILHGE\%XUHDX9HULWDV&HUWLILFDWLRQ Holding SAS-UK branch. To achieve best result and provide ample opportunity for learning growth, the HR policies and practices of the company is always kept in tune with the requirement of its most important resource i.e. Human Resource. The company discharges its corporate social responsibility most religiously.

30

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

L&T

Corporate

Larsen & Toubro is a major technology, engineering, construction, manufacturing and financial services conglomerate, with global operations. L&T addresses critical needs in key sectors - Hydrocarbon, Infrastructure, Power, Process Industries and Defence - for customers in over 30 countries around the world. L&T is engaged in core, high impact sectors of the economy and our integrated capabilities span the entire spectrum of ‘design to deliver’. With over 7 decades of a strong, customer focused approach and a continuous quest for world-class quality, we have unmatched expertise across Technology, Engineering, Construction, Infrastructure Projects and Manufacturing, and maintain a leadership in all our major lines of business.

Lohia Corp. Limited

Corporate

/RKLD&RUS/LPLWHGLVWKHÀDJVKLSFRPSDQ\RIWKH Lohia Group and a global supplier of machinery for end to end solution for plastic woven fabric industry used for packaging system for solid bulk materials and infrastructure applications. The company was incorporated in 1981.

Loyal Textile Mills Limited

Corporate

Loyal Textile Mills Limited is a vertically integrated Textile mills with five SBUs. One of the largest manufacturers of yarn, fabrics, garments, and organic products in India. With an annual turnover to the tune of `  FU 86  PLOOLRQ  ZLWK H[SRUWVWRDOPRVWHYHU\FRQWLQHQWDQGPDQ\¿UVWV in the textile domain to its credit, Loyal Textiles is today widely recognized as a leader in its league. Loyal Textile Mills Limited is a vertically integrated Textile mills with five SBUs. One of the largest manufacturers of yarn, fabrics, garments, and organic products in India. With an annual turnover to the tune of `  &U 86  0LOOLRQ  ZLWK H[SRUWVWRDOPRVWHYHU\FRQWLQHQWDQGPDQ\¿UVWV in the textile domain to its credit, Loyal Textiles is today widely recognized as a leader in its league. 31

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH

Macquarie Global Services

Corporate

7KH)LQDQFLDO0DQDJHPHQW*URXSSURYLGHV¿QDQFLDO tax and treasury services to all areas of Macquarie. The group is focused on providing strategic analysis and advice to Macquarie’s businesses and senior management, managing Macquarie’s funding, liquidity and capital position, ensuring Macquarie continues to meet regulatory and compliance obligations and managing Macquarie’s corporate communications and investor relations. Macquarie LVDJOREDOSURYLGHURIEDQNLQJ¿QDQFLDODGYLVRU\ investment and funds management services, with RIILFHVLQFRXQWULHV:HDUHDXQLTXHO\GLYHUVH business with deep specialist expertise. Key to Macquarie’s success is a unique structure and management style that fosters an entrepreneurial environment that is underpinned by a strong risk management framework, an approach that has contributed to its long history of success. This philosophy encourages a sense of ownership and entrepreneurial endeavour among our people and delivered value for clients.

Marlabs Software Private Limited

Corporate

Marlabs is a Digital Technology Solutions company that helps companies adopt digital transformation using a comprehensive Digita l360 framework comprising of Digital Product Engineering, Digital Automation, AI and Cognitive Platforms, Enterprise Analytics, Cloud, Digital Security and Digital User Experience; delivering a next-generation Digital Customer Experience. Headquartered in New Jersey, 8QLWHG 6WDWHV ZLWK  HPSOR\HHV 0DUODEV provides digital technology solutions to clients across GLɣHUHQWLQGXVWU\YHUWLFDOVZKLFKLQFOXGH+HDOWKFDUH and Life Sciences, Banking, Financial Services, Insurance, Airlines, Energy and Utilities, Education and Media, Retail, Manufacturing and Government.

Maruti Suzuki India Limited

Corporate

www.marutisuzuki.com

32

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

Muthoot Finance Ltd.,

Corporate

The Muthoot Group, a Financial Corporate house ZLWKXQEOHPLVKHGEXVLQHVVOHJDF\RIRYHU\HDUV The Group comprises of 18 diversified divisions viz., Gold Finance, Home Loans, Vehicle Finance, Insurance, Education, Hospitality, Healthcare, Plantations, Builders etc., The Group has global presence with operations in USA, UK, UAE, Central America & Srilanka. The Group has employee strength of Appx. 35000. Muthoot Finance Ltd., the ÀDJVKLSFRPSDQ\RIWKH*URXSODUJHVWJROGEDQNLQJ &RPSDQ\LQ,QGLDVHUYLQJRYHUODNKFXVWRPHUV every day.

NLC India Limited

Corporate

NLC India Limited (Formerly Neyveli Lignite Corporation Limited) is a premier `NAVRATNA` Central Public Sector Enterprise under Ministry of Coal / GOI. The company`s main activities are Mining (Lignite/Coal), Thermal Power Station and renewable energy (Solar/Wind).It has running/ upcoming projects at Neyveli/Tuticorin (Tamil Nadu), Barsingsar (Rajasthan), Ghatampur (UP) and Talabira (Odisha). Working force of the company consist of 4,045 executives, 379 supervisors and 10106 non executives. Present Annual Turn over of the company is INR 8496 Crore (approx.). For further details refer company website www.nlcindia. com

NMDC

Corporate

A Central Public Sector Undertaking under the administrative control of ‘Ministry of Steel’. The FRPSDQ\LVDFRQWLQXRXVO\PDNLQJSUR¿WVDQGSD\LQJ dividends to the shareholders. The turnover of the company as per the last published annual results is ` 9738 Cr and Profit Before Tax `&U7KH company has its operations in State of CG and State of Karnataka and State of MP. Corporate office at Hyderabad.

33

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH

NTT DATA Information Processing Services Private Limited

Corporate

At NTT DATA Services, we live for driving outcomes that keep you a step ahead in this digitally dynamic world. As a division of NTT DATA Corporation, a top 10 global services provider, we excel in blending IT and business expertise with decades of industry knowhow. And then we roll up our sleeves and get into the trenches with you. NTT DATA Services KLJKOLJKWV ‡ +HDGTXDUWHUV LQ 3ODQR 7; 86$ ‡ Largest division of NTT DATA Corporation and part of NTT Group, $106 billion1 global company • 50,000 professionals worldwide • Comprehensive portfolio of industry-centric business and technology solutions • World-class client experience centers LQ 3ODQR 7; 3DOR $OWR&$ %HQJDOXUX ,QGLD

ONGC Limited

Corporate

Maharatna ONGC is the largest crude oil and natural gas Company in India, contributing around 70 per cent to Indian domestic production. Crude oil is the raw material used by downstream companies like IOC, BPCL, and HPCL to produce petroleum products like Petrol, Diesel, Kerosene, Naphtha, and Cooking Gas-LPG. This largest natural gas company ranks 11th among global energy majors (Platts). It is the only public sector Indian company to feature in Fortune’s ‘Most Admired Energy Companies’ list. ONGC ranks 18th in ‘Oil and Gas RSHUDWLRQV¶DQGUGRYHUDOOLQ)RUEHV*OREDO Acclaimed for its Corporate Governance practices, 7UDQVSDUHQF\,QWHUQDWLRQDOKDVUDQNHG21*&WK among the biggest publicly traded global giants. It is most valued and largest E&P Company in the world, and one of the highest profit-making and dividend-paying enterprise. Oil and gas company in India ONGC has a unique distinction of being a company with in-house service capabilities in all areas of Exploration and Production of oil & gas and related oil-field services. Winner of the Best

34

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH Employer award, this public sector enterprise has a dedicated team of over 33,500 professionals who toil round-the-clock in challenging locations. ONGC Videsh is a wholly owned subsidiary of Oil and Natural Gas Corporation Limited (ONGC), the National Oil Company of India, and is India’s largest International oil and gas Company. ONGC Videsh KDV SDUWLFLSDWLRQ LQ  SURMHFWV LQ  FRXQWULHV namely Azerbaijan, Bangladesh, Brazil, Colombia, Iraq, Israel, Iran, Kazakhstan, Libya, Mozambique, Myanmar, Namibia, Russia, South Sudan, Sudan, Syria, United Arab Emirates, Venezuela, Vietnam and New Zealand. ONGC Videsh maintains a balanced portfolio of 15 producing, 4 discovered/under development, 18 exploratory and 4 pipeline projects. 7KH&RPSDQ\FXUUHQWO\RSHUDWHVMRLQWO\RSHUDWHV projects. ONGC Videsh had total oil and gas reserves 3 RIDERXW0072(DVRQ$SULO)RU PRUHLQIRUPDWLRQYLVLWZZZRQJFYLGHVKFRP*OREDO Ranking ONGC received Dun & Bradstreet Award  LQ WKH µ2LO DQG *DV ([SORUDWLRQ¶ FDWHJRU\ ONGC received 4 PSE Excellence Awards from ,QGLDQ &KDPEHU RI &RPPHUFH LQ  7KLV 7RS Energy Company in India, ranked 11th globally as SHU3ODWWV7RS*OREDO(QHUJ\5DQNLQJV Ranked 464 in the Newsweek Green Rankings :RUOG¶V *UHHQHVW &RPSDQLHV  5DQNHG WK among global Oil and Gas Operations industry in )RUEHV*OREDOOLVWRIWKH:RUOG¶VELJJHVW FRPSDQLHV IRU  5DQNHG  LQ WKH RYHUDOO OLVW   EDVHG RQ 6DOHV 86  ELOOLRQ   RQ 3URILWV  LQ $VVHWV DQG  0DUNHW 9DOXH 5DQNHG  LQ µ7UDQVSDUHQF\ LQ &RUSRUDWH 5HSRUWLQJ¶ DPRQJ WKH ZRUOG¶V  ODUJHVW OLVWHG companies published by Transparency International, 8SIURPLQ 21*&LVRQHRI,QGLD¶V

35

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH Most Valuable Corporations ONGC is one of the most valuable public sector enterprises working on Indian stock exchanges. ONGC Represents India’s (QHUJ\6HFXULW\WKURXJKLWV3LRQHHULQJ(ɣRUWV21*& is the only fully–integrated oil and gas company in India, operating along the entire hydrocarbon value chain. It has single-handedly scripted India’s K\GURFDUERQVDJD6RPHNH\SRLQWHUV7RS(QHUJ\ Company ONGC has discovered 6 out of the 7 oil DQG JDV SURGXFLQJ EDVLQV LQ ,QGLD 7KLV ODUJHVW energy company in India has established 8.70 billion tonnes of in-place hydrocarbon reserves. It has to its credit more than 570 discoveries of oil and gas ZLWK8OWLPDWH5HVHUYHVRI%LOOLRQ0HWULFWRQQHV %07 RI2LO3OXV2LO(TXLYDOHQW*DV22(* IURP domestic acreages. It has cumulatively produced 998 Million Metric Tonnes (MMT) of crude and 645 Billion Cubic Meters (BCM) of Natural Gas. ONGC KDV ZRQ  RXW RI D WRWDO  %ORFNV PRUH WKDQ 50%) in the 8 rounds of bidding, under the New Exploration Licensing Policy (NELP) of the Indian Government. ONGC’s wholly-owned subsidiary ONGC Videsh Ltd. (OVL) is the biggest Indian PXOWLQDWLRQDO ZLWK  2LO  *DV SURMHFWV LQ  FRXQWULHV21*&SURGXFHVRYHUPLOOLRQEDUUHOV of oil equivalent per day, contributing around

Oravel Stays Private Limited

Phillipos & Co

36

Corporate

OYO is South Asia’s largest hotel chain, founded ZLWKDVLQJOHPLVVLRQDWKHDUW±WRKHOSSHRSOH¿QG their perfect space in every place. We partner with asset and home owners, providing travellers and city GZHOOHUVH[FOXVLYHKRWHOVDFURVVWRZQVLQ FRXQWULHV:HDUHLQWKHEXVLQHVVQRWMXVWWRPHHW people’s expectations – we are here to exceed them.

Firm of Phillipos & Co. is a firm of Chartered Accountants Chartered founded in 1967 based in Bangalore by Wing Accountants Commander Alexander Phillipos. The firm has 6 chartered accountants as its partners,

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH $XGLWPDQDJHUVDQGVXSSRUWVWDɣ2YHUDSHULRG of 50 years the firm has developed a rich and vast data and knowledge base in Assurance Practice, Tax Practice, Corporate and Secretarial Services, and %XVLQHVV$GYLVRU\6HUYLFHVDQGRɣHULQJLWVVHUYLFH WR1*2¶VDQGFRUSRUDWH7KH¿UPLVHPSDQHOOHGZLWK The Reserve Bank of India and The Comptroller and Auditor General of India. The firm associated with audit of large listed bank and public sector undertaking like state bank of India, Punjab national EDQN%+(/OLPLWHGHWF7KH¿UPLVDFWLYHO\HQJDJHG in statutory audit, internal/management audit, investigation and special assignments, tax practice, corporate and secretarial services, business advisory services, business process outsourcing, setting up accounting systems and preparation of accounts manual and standard operating practices and payroll maintenance. Formation of NGO’s and companies. Regulatory compliance for NGO’s and corporate.

Price Waterhouse & Co Chartered Accountants LLP

Firm of Our Assurance Services provides assurance on the Chartered financial performance and operations of a client’s Accountants EXVLQHVVKHOSVEXVLQHVVHVLPSURYHH[WHUQDO¿QDQFLDO reporting and adapt to new regulatory requirements as per state laws/international standards. The Assurance group can also help organizations report externally on non-financial information, strengthen its corporate governance procedures, and achieve social and economic goals related to corporate sustainability. Financial audits provide an LQGHSHQGHQWRSLQLRQRQDFRPSDQ\¶V¿QDQFLDOUHSRUW and are a critical element in the capital markets system.

37

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH

Pricewaterhouse Coopers Private Limited

Corporate

$ERXW3Z&$W3Z&RXUSXUSRVHLVWREXLOGWUXVW in society and solve important problems. We are a network of firms in 157 countries with more than  SHRSOH ZKR DUH FRPPLWWHG WR GHOLYHULQJ quality in assurance, advisory and tax services. In ,QGLD 3Z& KDV LWV SUHVHQFH LQ PDMRU FLWLHV OLNH Ahmedabad, Bengaluru, Chennai, Delhi NCR, +\GHUDEDG.RONDWD0XPEDL3XQHHWF2XU&OLHQWV PwC India’s clients range from some of the world’s largest multinationals to many small and mediumsized enterprises. PwC India also works very closely with government and public sector companies, providing a wide spectrum of services. Line of 6HUYLFH /R6  EHLQJ RIIHUHG 7D[ DQG 5HJXODWRU\ Services Our practice helps enterprises formulate HɣHFWLYHVWUDWHJLHVIRURSWLPLVLQJWD[LQQRYDWLYHWD[ planning, reducing tax risk, managing compliance and resolving disagreements with tax authorities. 9DULRXVVHUYLFHVRɣHUHGDUH&RUSRUDWH7D[,QGLUHFW Tax, Transfer Pricing, International Assignments, Mergers & Acquisition, Regulatory Services and Tax Controversy and Dispute Resolution. Our DZDUGV DQG UHFRJQLWLRQV ,Q  %UDQG )LQDQFH ranked PwC as the second most powerful global brand. PwC was ranked the second most attractive employer and first among professional services LQ 8QLYHUVXP¶V  µ:RUOG¶V 0RVW $WWUDFWLYH Employer’ ranking. PwC’s Consulting practice has been consistently ranked at the top by clients and partners. Our most recent awards include the prestigious President Club Award for Microsoft '\QDPLFV$;DQGWKH6$3%HVW,PSOHPHQWDWLRQRI the Year Award for the most innovative and complex implementation of an Accounts Payable Optimisation solution. The Global Tax Monitor recognises PwC as the leading tax adviser globally, by reputation, with a very strong lead over the competition.

38

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

Pricewater house Coopers Service Delivery Centre (Kolkata) Private Limited

Corporate

PwC SDC Kolkata is a joint venture of member firms of Australia, Canada, India, the UK and the US. Part of PwC’s Service Delivery Network (SDN), PwC SDC Kolkata serves as a cornerstone of PwC’s global delivery model. Our business is organised into four lines of service -- Advisory, Assurance, 5LVN$VVXUDQFHDQG7D[:HKDYHRɤFHVLQ.RONDWD and Bangalore. In our sixth year of successful operation, we stand as an organisation of repute and an employer of choice.

Quess Corp

Corporate

4XHVV &RUS /LPLWHG %6(  16( QUESS), is India’s leading integrated business services provider. At Quess, we excel in helping large and emerging companies manage their noncore activities by leveraging our integrated service offerings across industries and geographies which provides significant operational efficiencies to RXU FOLHQWV 4XHVV KDV D WHDP RI RYHU a employees across India, North America, South America, South East Asia and the Middle East across segments such as Industrials, Facility Management, People Services, Technology Solutions DQG ,QWHUQHW %XVLQHVV 4XHVV VHUYHV RYHU  FOLHQWV ZRUOGZLGH (VWDEOLVKHG LQ  4XHVV LV headquartered in Bengaluru, India and has a market FDS RI RYHU 86'  EQ DV RQ 0DUFK  

Rashtriya Ispat Nigam Limited

Corporate

Rashtriya Ispat Nigam Limited (RINL) is the corporate entity of Visakhapatnam Steel Plant 963 ,QGLD¶V¿UVWVKRUHEDVHGLQWHJUDWHG6WHHO3ODQW built with state-of-the-art technology and a prime producer of long steel products in the country having extensive market in infrastructure, construction, automobile, electrical and forging industry. With an annual turnover of over Rs16000 crores, VSP is gearing up production to achieve rated capacity of 7.3 MTPA liquid steel having three Captive 39

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH 0LQHVDQG0DUNHWLQJ%UDQFKHV3DQ,QGLD)RUJHG Wheel Plant is another unit of RINL being setup at Raebareli, UP.

Reliance Industries Ltd.

Corporate

At Reliance, the focus on growth is continuous and relentless. Our motto “Growth is Life” aptly captures the ever-evolving spirit of Reliance. Our activities span hydrocarbon exploration and production, petroleum refining and marketing, petrochemicals, retail and telecommunications. In each of these areas, we are committed to innovationled, exponential growth. Our vision has pushed us to achieve global leadership in many of our businesses – including our position as the largest polyester yarn DQG¿EUHSURGXFHULQWKHZRUOG5HOLDQFH,QGXVWULHV Limited is a Fortune 500 company and the largest private sector corporation in India. As Reliance sets sights on even more ambitious goals, we remain inspired and guided by the story and philosophy of our founder chairman Dhirubhai Ambani. Hailing from modest means, he followed his dream to create India’s largest company. Reliance as an organisation has adopted this ethos of converting adversity into opportunity and making the impossible possible by challenging conventional wisdom. Our ultimate aim has always been – and will always be – to touch the lives of people in a positive way.

S. J. Chirania & Associates

Firm of M/s. S. J. Chirania & Associates was constituted Chartered RQ 'HFHPEHU   vide Firm Registration Accountants 1R : ZLWK WKH ,QVWLWXWH RI &KDUWHUHG Accountants of India. The firm endeavour in providing Audit, Taxation and Corporate Advisory Service & has served various Corporates and other entities

S. R. Batliboi & Co. LLP

Firm of S R Batliboi & Co. Chartered Accountants

40

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

Saint Gobain India Private Limited

Corporate

Headquartered in Paris, Compagnie de Saint-Gobain, the holding company of the Group, is a publicly traded company that traces its origins back to 1665. Today, Saint-Gobain, the world leader in the habitat and construction markets, designs, manufactures and distributes building materials, providing innovative solutions to the challenges of growth, energy efficiency and environmental protection. :LWKVDOHVFORVHWR¼ELOOLRQ6DLQW*REDLQ operates in 67 countries and has nearly 170,000 HPSOR\HHV 6DLQW*REDLQ *URXS LQ ,QGLD 6DLQW Gobain established its presence in India by acquiring a majority stake in Grindwell Norton in 1996, and thereafter went on to consolidate and strengthen its presence within the country. The Group has adopted a systematic focus in launching its individual businesses in India and currently operates in WZR EXVLQHVV VHFWRUV ,QQRYDWLYH 0DWHULDOV DQG Construction Products. These businesses in the SG India group are under four legal entities of which Grindwell Norton Limited and Saint-Gobain Sekurit India Limited are listed entities.

Sasken Technologies Limited

Corporate

Sasken is a specialist in Product Engineering and Digital Transformation providing concept-to-market, chip-to-cognition R&D services to global leaders in Semiconductor, Automotive, Industrials, Smart Devices & Wearables, Enterprise Grade Devices, DQG 6DW&RP LQGXVWULHV )RU RYHU  \HDUV DQG with multiple patents, Sasken has transformed the businesses of over a 100 Fortune 500 companies, powering over a billion devices through its services and IP.

41

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH

Shell India Markets Pvt. Ltd.

Corporate

SBO-Chennai is one of Shell’s fastest growing Business Operations locations, and plays a crucial role in delivering Finance Operations activities including continuous improvement for both Finance and Enterprise-wide data organization. Finance & Data Operations provides a single point of accountability for operating Finance & data processes, through standardization/best practice operations, continuous improvement and controls globally. An SBO-Chennai career could see you carrying out core Shell business Financial & Data Operations such as reporting & analysis, direct taxation, controls & compliance, local statutory reporting, data management and analytics. Chennai also houses global operation commercial services and customer operations for Trading and Lubricants respectively. At SBO-Chennai you will play an instrumental role in seeing that our world class standards are upheld across our global markets. As such, we are looking for individuals with a desire to learn and contribute to our continued success. With us, you will enjoy competitive remuneration DQGEHQH¿WVSHUVRQDODQGSURIHVVLRQDOGHYHORSPHQW opportunities, and be part of an inclusive working environment that values Shell’s core principles of honesty, integrity and respect for each other.

Suresh Surana & Associates LLP

42

Firm of Suresh Surana & Associates LLP (SSA Group) Chartered along with its affiliates, is one of the leading Accountants accounting and consulting groups in India, with group personnel strength of over 800. Suresh Surana & Associates LLP (SSA) offers a wide range of specialized, multi-disciplinary professional services that meet the immediate as well as the long-term business needs of clients. SSA Group has a pan-India SUHVHQFHZLWKRɤFHVLQ0XPEDL1HZ'HOKL1&5

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH Bangalore, Chennai, Kolkata, Surat, Ahmedabad, and Gandhidham. SSA Group provides a wide range of SURIHVVLRQDOVHUYLFHZLWKVSHFLDOIRFXVRQWKH¿HOGV of Internal/ Management Audits, Corporate Advisory, Risk Management and Attestation. SSA Group’s international affiliation and experience enables it to meet the cross border services requirements of its clients. SSA Group’s focus has been on building strong client relationships through consistency of services. Over the years, we have built a strong competitive presence in all our focus sectors. We work with both Indian and international companies whose inherent quality and business potential position them well as top class organizations, current or potential.

Tata Consultancy Services Ltd.

Corporate

Tata Consultancy Services is an IT services consulting and business solutions organisation that delivers real results to global business ensuring a level of certainty no other firm can match. TCS RɣHUVDFRQVXOWLQJOHGLQWHJUDWHGSRUWIROLRRI,7%36 infrastructure engineering and assurance services. This is delivered through its unique Global Network Delivery Model recognised as the benchmark of excellence in software development. A part of the Tata group Indias largest industrial conglomerate TCS has over 3,85,000 of the worlds best trained consultants in 46 countries. The company generated consolidated revenues of 17.58 billion USD for \HDU HQGHG 0DUFK   DQG LV OLVWHG RQ WKH BSE Limited and National Stock Exchange of India Limited

43

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH

TATA Projects

Corporate

Tata Projects is one of the fastest growing and highly admired infrastructure companies in India. The company is reputed for its ability to successfully execute large and complex industrial infrastructure projects and urban infrastructure projects. The tag line is Simplify. Create Simplify We strive to simplify complexity and create world class projects on time by leveraging our understanding of technology, advanced construction practices and engineering expertise built over three decades. Create Exceptional execution is the key to create projects on time. Tata Projects leverages technology, advanced construction methods and well orchestrated collaboration between diverse specialists to ensure flawless and on time execution of projects. Working with integrity, we ensure that all our solutions are infused with the highest standard of quality and safety.

Teleysia Networks Pvt. Ltd.

Corporate

Teleysia Networks has started operations in April,  ,W LV DQ LQQRYDWLYH DQG HIILFLHQW VROXWLRQ providing telecom consultancy company with a mission to become the most preferred company for our customers and employees. Our engineering team can work across India, in multi-cultural working environment.

The Catholic Syrian Bank Ltd.

Corporate

1LQH GHFDGHV DJR RQ WK 1RYHPEHU  WR EH exact at Thrissur,which in later years acquired the unique distinction of being a centre with the highest concentration of banks in the South, The Catholic Syrian Bank was born. In August 1969, the Bank was included in the Second Schedule to the Reserve Bank of India Act, 1934. In 1975, the Bank attained the status of “A” Class Scheduled Bank when its total Deposits crossed `  FURUHV 7KH QHFHVVLW\RILPSDUWLQJWUDLQLQJWRVWDɣORRNHGYHU\ important and a modest beginning was therefore,

44

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH made in setting up a Training College in 1975. In WKHVDPH\HDUWKH%DQNHQWHUHGWKH¿HOGRIIRUHLJQ Exchange. At a very early stage, the Bank recognised mechanisation as an effective tool of management and streamlined its accounting procedures by introduction of Data processing system. From November 1975, reconciliation of inter-branch accounts was mechanised by using IBM Data processing machines. At present, the bank has a QHWZRUNRIRYHUEUDQFKHVDQGPRUHWKDQ ATMs across India. The Bank also plans to open more number of branches in a phased manner.

The Federal Bank Limited

Corporate

Federal Bank Limited is a major Indian commercial bank in the private sector headquartered at Aluva, Kerala having more than thousand branches and ATMs spread across different States in India. The Bank is a pioneer among traditional banks in India in the area of using technology to leverage its operations and was among the first banks in India to computerize all its branches. The Bank offer its customers, a variety of services such as Internet banking, Mobile banking, on-line bill payment, online fee collection, depository services, Cash Management Services, merchant banking services, insurance, mutual fund products and many more as part of its strategy to position itself as a financial super market and to enhance customer convenience. The history of Federal Bank dates back to the pre-independence era. The Bank was LQFRUSRUDWHG RQ $SULO   DV WKH 7UDYDQFRUH Federal Bank Limited, Nedumpuram under the Travancore Companies Regulation, 1916. Late K.P. Hormis, the visionary banker and founder took up the reigns in 1945 and built the bank a nationwide institution. The Bank’s name was changed to The Federal Bank Limited on December

45

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH 7KH%DQNZDVOLFHQVHGXQGHUWKH%DQNLQJ Regulation Act, 1949, on July 11, 1959 and became a scheduled commercial bank under the Second Schedule of Reserve Bank of India Act, 1934 on July   7RGD\ WKH EDQN LV SUHVHQW LQ  6WDWHV Delhi NCT and 4 Union Territories and the bank is listed in BSE, NSE and London Stock Exchange.

The KCP Limited

46

Corporate

.&3LVD\HDUROGGLYHUVL¿HGEXVLQHVVJURXSZLWK D WXUQRYHU RYHU  PLOOLRQ 86' ZLWK LQWHUHVWV in Cement, Heavy Engineering, Sugar, Power and IT. It has 9 manufacturing locations over various geographies in India and Vietnam. KCP started as a small cooperative sugar plant in 1941 by its founder Sri. V. Ramakrishna; it has over the years expanded rapidly enthused by the leadership of its founder and inspired on the lines of the technological foresight into other areas like Heavy Engineering (1955), &HPHQW 3RZHU DQG+RVSLWDOLW\  Technology provides the cutting edge to our services, state of the art facilities and latest process trends that are applied in areas such as critical industrial equipment for mineral processing and chemical industries, steel plants, space research applications and Nuclear / Hydro power installations. KCP, with its technology & project management capability, KDV VHW XS RYHU  VXJDU SODQWV DQG  FHPHQW factories in India and overseas. KCP ‘s focus has always been towards contributing to the nation’s lifelong infrastructure. Its Cement Plant in Macherla was setup to supply cement for the construction of the mighty Nagarjunasagar Dam. This stands as a testimony to the quality of KCP Cement. The dam continues to provide irrigation and power to State of Andhra Pradesh. Fives-Cail KCP Limited is a Joint Venture with Fives Group, France to execute turnkey Sugar Plants.

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH

Thomson Reuters International Services Private Limited

Corporate

We are the leading source of intelligent information for the world’s businesses and professionals, providing customers with competitive advantage. Intelligent information is a unique synthesis of human intelligence, industry expertise and innovative technology that provides decision-makers with the knowledge to act, enabling them to make better decisions faster. We deliver this must-have insight WRWKH¿QDQFLDODQGULVNOHJDOWD[DQGDFFRXQWLQJ intellectual property and science and media markets, powered by the world’s most trusted news organization.

Tolaram Group

Corporate

ESTABLISHED IN 1948 IN MALANG, INDONESIA Tolaram Group is headquartered in Singapore with business interests currently in Asia, Africa and Europe. We trade with companies in over 75 countries. The Group has a diversified portfolio consisting of Consumer Goods, Infrastructure, Energy, Digital Services and other interests which include Distribution, Financial Services, Paper Products, Real Estate and Textiles.

TVS Motor Company Limited

Corporate

TVS Motor Company is the third largest twowheeler manufacturer in India, with a revenue RI  &U ,15   7KH FRPSDQ\ KDV DQ DQQXDOSURGXFWLRQFDSDFLW\RIPLOOLRQZKHHOHUV    ZKHHOHUV796 *URXS VSDQV DFURVV industries like Automobile, Aviation, Education, Electronics, Energy, Finance, Housing, Insurance, Investment, Logistics, Service and Textiles. Has over 90 Companies under the umbrella. TVS Motor Company Ltd. (TVS Motor), a member of the TVS Group (Revenue around INR 40,000 Cr ), is the largest company of the group in terms of size and turnover. Sundaram Clayton Limited (SCL) is part of the $6.5 billion TVS group, one of the largest auto components manufacturing and distribution group 47

The Institute of Chartered Accountants of India

Company Name

Entity

6KRUW3UR¿OH in India. SCL is a leading supplier of aluminium die castings to automotive and non-automotive VHFWRU6LQFHFRPPHQFLQJRSHUDWLRQLQ6&/ has achieved many milestones and emerged as one of the preferred solution provider in machined and sub-assembled aluminium castings. Our contribution commences from early design stage to development DQGVXSSO\RI¿QLVKHGSURGXFW2YHUWKH\HDUVZH have built strategic partnership with global OE / Tier one. With the robust manufacturing driven by TQM, TPM, Lean practices and investments in state of the art technologies, SCL is poised to serve the future needs of the industry in light metal castings.

V. Singhi & Associates

Vedanta resources Pvt. Ltd.

48

Firm of V. Singhi & Associates, Chartered Accountants, is one Chartered RIWKHOHDGLQJDXGLWLQJDQGDGYLVRU\¿UPVLQ,QGLD Accountants We drive beyond service and add value to our clients. We have presence over 7 major cities i.e. Kolkata, Mumbai, New Delhi, Hyderabad, Bangalore, Jaipur & Guwahati. Corporate

We operate on the belief that our people are our core assets and we consistently endeavour towards developing their potential to be our future leaders and key employees. We currently operate in India, Zambia, Namibia, South Africa, Liberia, Ireland and Australia through our various subsidiaries. We seek to attract talent especially in mining, metallurgy, geology, smelting and sustainability for our worldwide operations. Empowerment of the community requires a synergic satisfaction of human needs and our view is that a shared destiny approach will benefit the community and boost economic prosperity. With a business model of growth, constant value creation and improved operations, the company’s vision is focused towards sustainably satisfying the needs of all our stakeholders by engaging the community we operate in. We have

How to face an Interview Board

Company Name

Entity

6KRUW3UR¿OH adopted a positive attitude to make our Sustainable Development initiatives successful for all. Vedanta has completed 10 years as a London Stock Exchange listed company. In this decade Vedanta’s revenue has JURZQIURPPLOOLRQWRELOOLRQ

VISA Steel Ltd.

Corporate

9,6$ 6WHHO LV RSHUDWLQJ D  73$ %ODVW Furnace, 300,000 TPA Sponge Iron Plant & 500,000 TPA Steel Plant through Electric Furnace route and 150,000 TPA Ferro Chrome Plant at Kalinganagar in 2GLVKD7KH&RPSDQ\LVKDYLQJLWV5HJLVWHUHG2ɤFH in Bhubaneswar; Corporate office in Kolkata and %UDQFK2ɤFHVDFURVV,QGLDZLWKDUHSXWHG%RDUGRI Directors, experienced and professional Promoters and Management Team, who have a strong track record in business and industry. VISA Steel’s shares are traded on the BSE and NSE.

Wipro Ltd.

Corporate

Wipro Limited is an Indian Information Technology Services corporation headquartered in Bengaluru, ,QGLD)RXQGHG'HFā,QGLD5HYHQXH ELOOLRQ86'

49

The Institute of Chartered Accountants of India

³7KHMRXUQH\RIDWKRXVDQGPLOHV EHJLQVZLWKDVLQJOHVWHS´ LAO TZU

50

Section II Personality to Succeed In this section... 1.

Good Grooming

 &RPPXQLFDWLRQ6NLOOV

51

The Institute of Chartered Accountants of India

³
52

How to face an Interview Board

Good Grooming The process of judging starts as soon as you enter the interview room. It is important WKDW\RXU¿UVWLPSUHVVLRQRQWKHSDQHOOLVWLVYHU\JRRG
Wear formal clothes.

„

Use talcum powder or mild deodorants to avoid body odour.

„

Avoid use of strong perfumes as many people have strong averse and even allergic to them.

„

Make sure that your hair is well shampooed. Avoid oily hair.

„ %ULQJDSURIHVVLRQDOORRNLQJIROGHUWRFDUU\UHVXPHPDUNVKHHWVFHUWL¿FDWHVDQG testimonials with you. „ .HHS\RXUFHOOSKRQHVZLWFKHGRɣRULQVLOHQWPRGHEHIRUHHQWHULQJWKHURRP Keeping it even on vibrating mode may distract you. STANDARDS FOR MEN Hair „ Hair should be neatly combed. Nicely trimmed, not extending below the ears. „

Avoid using colours unless and until it is essential.

Face „ The face should be clean shaven and there should be no stubbles. „

If there are moustaches, they should be well trimmed, above the lip level and not drooping.

„

Beards should be avoided except in cases of religious reasons.

Hands „ Avoid sweaty palms, wipe them before entering the interview room. „

Nails should be clean and well manicured.

Interview attire The following are the dress requirements needed for formal interview attire, as well as VXJJHVWLRQVRQKRZWRDFKLHYHDQRYHUDOOSURIHVVLRQDOORRN 53

The Institute of Chartered Accountants of India „

Your dress should be sober, clean and well ironed.

„

Wear a pastel colour shirt which should be full sleeved with contrasting tie.

„

Wear formal trousers. The best colours to go for are conservative ones like black or blue.

„ 7KHVKLUWSRFNHWVKRXOGQRWEHORDGHGZLWKVWXɣ „

Wear business suit or formal coat.

„

Avoid jewellery.

Shoes „ Should be of black or dark brown colour and must be co-ordinated with the clothes worn. „

Should be in good condition and properly polished.

„

Laces should be tied neatly at all the times. Avoid shoes without laces.

„

The colour of the socks should match with the colour of the trouser.

STANDARDS FOR WOMEN Hair Long hair „ Should be left open only if they are of shoulder length. The following are to be DYRLGHG •

Elaborated hairstyles, knots or coils. Low loose knots tied at the nape of the neck.

•

Oily hair.

Short hair „ Should be cut in an elegant contemporary style which is manageable and looks neat. Face „ Eyebrows should be neat and well-shaped, skin should be well-cared for facial hair should be bleached or removed regularly.

54

How to face an Interview Board Make up „ Should be light and must look neat. Hands „ Should always be clean and well manicured. ‘Mehndi’ designs should be avoided. „

Nails should be well shaped with a light to medium colour application of nail polish.

„

Extremely long nails with very bright or dark shades of nail polish should be avoided.

„ 1DLOSROLVKVKRXOGQRWEHFKLSSLQJRɣ Shoes „ Low-heeled or high-heeled shoes or sandals are appropriate with most clothes. „

Shoes and sandals with back straps should be in good condition.

Jewellery „ Light authentic jewellery, e.g., a thin gold chain, a light gold bangle, small gold, pearl or diamond earrings add to style. „

Artificial or costume jewellery in oxidized silver or plastic should be strictly avoided at work.

„

Bangles should not jangle.

„

Avoid anklets.

Interview attire „ Women should wear a well tailored business suit in conservative colours such as EODFNGDUNEOXHRUGDUNJUH\ZLWKD¿QHSULQW „

Scarf and shoes must be well coordinated with the business suit.

„

Sarees must be well-ironed. If cotton, a little starch adds wonders. The falls must be well-stitched on, with no bits hanging apart.

55

The Institute of Chartered Accountants of India

Communication Skills Communication is a two way process of exchanging messages in form of information, views or ideas. It involves transmitting and receiving verbal and non-verbal messages. &RPPXQLFDWLRQLVFRQVLGHUHGHɣHFWLYHLILWDFKLHYHVWKHGHVLUHGUHVSRQVHIURPWKH receiver. Communication skills, both inter-personal and intra-personal, are essential to be successful in group discussion and interviews. This is because, though all chartered accountants, no doubt, are very capable and strong in the knowledge of the subject which they have studied the hard way. The presentation of their knowledge has to stand the test conducted. It is therefore intended to design the various aspects of the winning communication, in order to enable the young chartered accountant to place him/her in a better position and in a satisfactory manner, when he/ she faces the interview panel. Non-verbal communication Are you aware that only a small percentage of the impression you make on other people stems from purely verbal communication, i.e. from the words you use ? What makes a much greater impact is the so-called non-verbal messages. These include all forms of communication other than the actual words and their meanings, i.e. „

Voice pitch and emphasis.

„

Pupil size.

„

Speed of speech.

„

Distances/territories.

„

Breathing.

„

Gestures/movements.

„

Posture/stance.

„

Clothing/dress.

„

Footwear, jewellery and accessories.

„

Facial expressions.

„

Status symbols/other objects.

56

How to face an Interview Board „

Eye contact.

„

Eye movement.

A mass of literature has appeared in recent years on this topic and there is a range of GLɣHUHQWJURXSLQJVDQGQDPHVIRUWKHYDULRXVHOHPHQWVRIQRQYHUEDOFRPPXQLFDWLRQ which we have detailed here. The term “body language” is often used to mean nonverbal communication. 7KHPRVWVLJQL¿FDQWIHDWXUHVRIQRQYHUEDOFRPPXQLFDWLRQDUHERG\ODQJXDJHYLVXDO  and voice (sound attributes, not spoken words). How do we communicate? 3XUSRVH7RHVWDEOLVKWKHVLJQL¿FDQFHRIQRQYHUEDOFRPPXQLFDWLRQ :KDWWRGR,PDJLQH\RXDUHPHHWLQJVRPHRQHIRUWKH¿UVWWLPH $VN\RXUVHOIKRZPXFK\RXFRPPXQLFDWHE\ „

The actual words you say.

„

The way you say those words, e.g., tone and speed.

„

Your body language.

Put in basic terms, body language is the message you receive when you watch a silent ¿OPRUDWHOHYLVLRQSURJUDPPHZLWKWKHVRXQGWXUQHGGRZQ Body language tells you more about what people really mean than all the words in any spoken language in the world. Anyone you communicate with-male or female, customer, colleague, family, friend, child, sales person, politician - all use non-verbal communication. At any given moment, your brain can assume a certain attitude and communicate WKLVWRYDULRXVSDUWVRI\RXUERG\ZKLFKSURPSWO\UHVSRQGVZLWKVSHFL¿FDFWLRQVRU expressions, i.e. Body language. Many of the gestures and signals sent out by the body are communicated to the surrounding world without us consciously realizing it. Body language includes Movements, posture, sitting position, use of the arms, facial expression, emotions, eye movements, handshake, way of walking, distance from others (territories), dress, etc. Even apparently very small, ordinary gestures are noticed. It is one thing to be able to interpret other people’s body language but it is quite another to be able to master your own body language and realize its relevance to the message you are giving. 57

The Institute of Chartered Accountants of India If you want some cast iron examples of the importance of body language, consider actors, teachers, instructors, salesmen (and service-givers with direct customer contact). The words they use are often the same (or most), but whether they are good or bad in the role, succeed or not, depends entirely on their mastery of body language and the degree to which their words and body language convey the same message. When you have learned how to interpret body language you will have opened the door to a new world! Words may lie but the body seldom does! It requires training to interpret other people’s body language, but it can be done. You can ascertain whether the people you are communicating with are lying, bored, impatient, sympathetic, defensive, agreeing or disagreeing. You can decide whether they are open, nervous, calculating, suspicious, angry, worried, insecure, etc. The importance of this to people in a service situation is obvious. You can also learn to see hidden, social, emotional and other intentions in the gestures of someone you know or want to know. Body language during an interview During an interview, your body language is telling the interviewer many things. +HVKHFDQWHOOLI\RXDUHQHUYRXVRUVHOIFRQ¿GHQWDQGSRLVHG The language of nervousness „ Sitting tensively at the edge of a chair, ready to run „

Cracking one’s knuckles.

„

Anxious look on one’s face.

„

Not looking directly at the face and eyes of the person speaking to you. Instead, looking down or shifting eyes around the room.

„ )HHWNQHHVKDQGV¿QJHUVWDSSLQJLQDQHQGOHVVZD\ „

Playing with keys, mobile phone or tapping a pencil.

„ 1HUYRXVODXJKWHURUFRQVWDQW¿[HGVPLOH „

58

Coughing, voice cracking while speaking.

How to face an Interview Board The language of arrogance „ Sitting too relaxed in your chair. „

Lounging back with legs crossed widely at the knee.

„

Head thrown back and looking and speaking down over the node.

„

Talking while playing with keys or tapping a pencil.

„ $SDWURQL]LQJDQGRYHUFRQ¿GHQWPDQQHUSXWVSHRSOHRɣDQGPDNHVRQHDPRVW unacceptable candidate. 7KH ODQJXDJH RI FRQ¿GHQFH „ Sitting well back on the chair. „

Body still and upright but not rigid.

„

Looking directly at anyone talking to you.

„

Turn by turn creating eye contact with all the members of the board you speak to.

„

Speaking naturally.

„

Sometimes smiling when you speak (not giggling or simpering).

„ ([XGLQJSOHDVDQWQHVVFRQ¿GHQFHDQGSRLVH How to Improve English „ Read good informative English books, professional journals, etc. „

Refer English dictionary on a regular basis, for meanings associated with new words and improvement of vocabulary.

„

Try to communicate with friends and near and dear ones in English to improve ÀXHQF\

59

The Institute of Chartered Accountants of India

³7KHPRUH\RXDUHZLOOLQJWR DFFHSWUHVSRQVLELOLW\IRU\RXUDFWLRQV WKHPRUHFUHGLELOLW\\RXZLOOKDYH´ BRIAN KOSLOW

60

Section III How to succeed in a Group Discussion

61

The Institute of Chartered Accountants of India

³$OZD\VEHDULQPLQGWKDW\RXURZQ UHVROXWLRQWRVXFFHHGLVPRUH LPSRUWDQWWKDQDQ\RQHWKLQJ´ Abraham Lincoln

62

How to face an Interview Board

How to Succeed in a Group Discussion Group discussion is a forum for free exchange of information/views in order to achieve consensus. Group discussions are meant to judge your communication and interpersonal abilities. The observers will be looking for verbal and non-verbal skills, clarity of thought, leadership abilities and other inter-personal skills. Background It is increasingly used as a tool for screening the candidates. It has been included as a vital part of selection process by the employers because these days decision PDNLQJLQWKHRUJDQL]DWLRQLVHɣHFWHGWKURXJKPHHWLQJVEUDLQVWRUPLQJVHVVLRQVDQG JURXSGLVFXVVLRQV(YHU\HPSOR\HHPXVWEHDQHɣHFWLYHFRPPXQLFDWRUWREHDEOHWR participate in the group decision making process in an organization. With this premise, LWLVFRQVLGHUHG¿WWRWHVWWKHFDQGLGDWHV¶VNLOOVLQDJURXSVHWWLQJ How can it help you on your job ? Imagine yourself working in a corporate setting. You are required to prepare an investment plan to manage the organisation funds optimally to earn maximum money IURPWKHFRPSDQ\¿QDQFHV
The Institute of Chartered Accountants of India or remote relation with the topic assigned. First and foremost, the attention of the group should be brought back to the topic of discussion, and not waver ambiguously. If members present divergent views, the different points should be discussed and a conclusion should be drawn. At the end of the discussion, the entire group must have arrived at some degree of common understanding and generated consensus i.e. Reached a decision/understanding acceptable to all. If all members keep making points of their own without establishing any connectivity EHWZHHQWKHSRLQWVÀRDWHGLWZRXOGEHPRUHOLNHDFURZGRUDFDFRSKRQRXVVHWWLQJ$ group leader is one who synergizes the energy of all by discussing each view point in the common forum and establishing common understanding on the issues discussed. Unless this activity is carried out, it would be more a motley crowd seated together and VD\LQJGLɣHUHQWWKLQJVWKDQDJURXSKHDGLQJWRZDUGVDIUXLWIXOGLVFXVVLRQ The objective is to assess if one is a good team player, has leadership potential, is facilitative by nature, empathizes with others, encourages others and at the same time displays good communication skills and stays focused on the subject. Topic for discussion $WRSLFRIFRPPRQLQWHUHVWLVÀRDWHGE\WKHLQWHUYLHZERDUG$PHPEHURIWKHERDUG announces a topic and leaves the forum open for the members to participate in. The interview board usually does not introduce the topic or give any qualifying remarks. The candidates should keep a paper and pencil handy to jot down their thoughts and keep their points ready before speaking in the group. It is usually a good practice as it helps to organize oneself and also to make a note of the point of view of others, which they may want to question. 7KH¿UVWPLOHVWRQHLQDJURXSGLVFXVVLRQLVXQGHUVWDQGLQJWKHREMHFWLYHDQGUHOHYDQFH of the topic in the context of the post being interviewed for, though there need not be any clear linkage. The importance of understanding the title of the topic can’t be over emphasized. In case you are confused on the subject, wait for others to start and try to decipher the import of the topic. However, if you feel that the title of the topic is nowhere close to your imagination, do not hesitate to put up the issue of clarifying the meaning of the topic. You may instead earn credit points for your candour. Take care not to ask the meaning of presumably well known topics that you may be unaware of as that would be tantamount to displaying your ignorance. To facilitate the process, familiarize yourself with the topics that are very much in the news during the last one-month and have relevance to the interview. Other 64

How to face an Interview Board topics, which may bring milestone type changes in business world e.g., ‘Sustaining Development in the Era of Financial Crisis’, should also be studied. Who begins the discussion ? One who initiates the discussion usually earns credit points to himself, a fact very well noted by the board. In a test setting, everyone’s eyes are keen on who begins the discussion. As soon as the topic is announced you must gather your thoughts and determine if you have matter worthy of an opening remark. If you have command over the topic, you may begin the discussion with an opening remark that will be registered. Take care not to miss the bus, thinking that a point should be made only if it is extremely good. You can quickly chip in to make your point otherwise someone else will state that point. It is also important to remember that what you speak will automatically capture the attention of the rest of the members of the group. You would realize that after you have made your presence in the discussion felt, your nervousness/ KHVLWDWLRQZLOOZHDURɣ,I\RXDUHDEOHWRFKDQJHWKHFRXUVHRIGLVFXVVLRQDQGJLYHLW a new direction by factual data and logic, you may perhaps win a point. Approaches Two approaches may be followed to determine the order of member’s participation. 8QUHJXODWHG$Q\FDQGLGDWHFDQSDUWLFLSDWHLQDQ\VHTXHQFH1RUXOHRURUGHULV GH¿QHGIRUSDUWLFLSDQWWRVSHDN,WPD\EHLPSRUWDQWWRXQGHUVWDQGWKDWLQUHDOOLIH VLWXDWLRQVQRERG\ZLOOQHFHVVDULO\JLYHVSHFL¿FWLPHWRDOOWRH[SUHVVWKHPVHOYHVDQG thus this approach may actually be more realistic. 5HJXODWHG7KHRUGHULQZKLFKPHPEHUVZLOOSDUWLFLSDWHLVSUHGHWHUPLQHGE\WKH candidates themselves at the beginning of the discussion. All candidates are asked to speak in sequential order to present their ideas. After each one has spoken his/her point, the forum becomes open and unregulated by any order or sequence. A variation of this method may also be followed where all the participants may be required to summarize the session in a determined sequence. The opening remark and/or closing remark may be made by the group nominated leader or by any one at random chosen by the supervisor. It is at the discretion of the supervisor. Example$WWKHHQGRIWKHJURXSGLVFXVVLRQWKHPHPEHUVRIWKHERDUGVD\³ZHZRXOG OLNHHDFKRQHRI\RXWRVXPPDUL]HWKHRXWFRPHRIWKHGLVFXVVLRQLQPLQXWHV´3OHDVH remember clearly that the summary has to be of the discussion which actually took place. Some students make a mistake by incorporating the points which they wanted 65

The Institute of Chartered Accountants of India to emphasise but they could not because of time constraints or loss of memory at the GHVLUHGWLPH+HUHWKH\WU\WRDFKLHYHWZRREMHFWLYHV 1

Give everyone a chance to speak.



)LQGRXWKRZDWWHQWLYHDFDQGLGDWHLVDQGKRZZHOOKHVKHKDVJUDVSHGWKHJLVWRI the discussion.

$WLPHOLPLWLVSUHGH¿QHGDWWKHVWDUWRIWKHGLVFXVVLRQ$VSHFL¿FWLPHZLOOEHJLYHQWR the participants to go through the reading material given to them if the discussion is WREHEDVHGRQFDVHVLWXDWLRQ8VXDOO\WRPLQXWHVDUHDOORWWHGIRUWKHGLVFXVVLRQ 7KHFDQGLGDWHVGLVFXVVWKHWRSLFIRUWKHVSHFL¿HGWLPHZLWKQRLQWHUIHUHQFH *URXSVL]HThe size of the group may vary from 6 to 10, beyond which however such a group becomes unmanageable. Ideally a group should have 7 to 8 members. 7HVWRIVNLOOV Broadly speaking group discussions test two types of skills. They are managerial skills and leadership skills. „

Managerial skills to be tested: communication (clarity of thought and expression and appropriate language), catch presentation (forceful argument to the attention of others), interpersonal skill (ability to interact with others, place others, objectivity, listening to others), problem solving (analytical and logical approach, creativity and innovation).

„

Leadership skills to be tested: team building (involve others), initiative and GULYHSURYLGHGLUHFWLRQ VHOIFRQ¿GHQFHDELOLW\WRZRUNXQGHUVWUHVVYLVLRQDQG foresight.

Points to improve the performance in group discussion Take Initiative „ Enter the discussion in a measured manner. „

Choose the correct point of entry.

„

Present each view forcefully and convincingly.

„

Conclude each argument at the right time.

Personal skills „ Be relaxed. „

Be pleasant and courteous to others.

„ %HFRQ¿GHQWDERXWZKDW\RXZDQWWRVD\ 66

How to face an Interview Board „

Address each person by his/her name.

7KLQNLQJUHDVRQLQJ „ Think in a logical and rational sequence. „ 6KRZFRQVLVWHQF\RILGHDVDOOSRLQWVVWDWHGVKRXOGKDYHFRQVLVWHQF\RIWKRXJKW „

Be quick in thinking and react to points made by others.

'LVSOD\ NQRZOHGJH „ Have the facts right, before expressing them before the group. „

Try to relate disparate day-to-day events to the point being discussed. If you are not able to understand the technical term/Abbreviations used by another PHPEHULWLVLQRUGHUWRDVNIRUFODUL¿FDWLRQVDVORQJDVWKDWLVQRW\RXURZQDUHD of specialization)

„

Display your grasp of knowledge on the subject.

„

Quote examples of recent developments that have taken place in the USA and Europe or changes that are in the pipeline in those places and in India in the UHODWHG¿HOGFRYHUHGE\WKHWRSLF

3DUWLFLSDWLRQ „ Speak as often as possible. „ 3DUWLFLSDWHLQDVXVWDLQHGZD\GRQRWOHDYHORQJJDSVZLWKRXWVSHDNLQJ „

Participation is not necessarily the duration and frequency of your speaking, but the number of value inputs you give to the discussion.

„

Allow others to speak as well; be facilitative.

„

Listen emphatically. Remember that a great leader is also a good listener.

„

It is not necessary that your participation has to be by making a fresh point. At the same time, just agreeing to what someone else mentions is no real contribution. You can disagree with the views of others by giving logic as to why you disagree.

„

Get in the midst of discussion only when the current speaker has completed a sentence and given a pause. This is to ensure that he/she is not unduly LQWHUUXSWHG2WKHUZLVHKHVKHPD\SXW\RXGRZQE\VD\LQJµ/HWPH¿QLVK¶

9DOXH DGGLWLRQ „ Each point you make should enhance the quality of the discussions. 67

The Institute of Chartered Accountants of India „

Make original points rather than expressing options about someone else’s points.

„

Decide what stand you would take about the topic and stick to it.

„

Do not be repetitive.

„ 'RQRWGLJUHVVIURPWKHWRSLFLQWRDQXQUHODWHG¿HOG Communication skills „ Express your ideas clearly. Clarity of expression comes naturally to those who have clarity of thought. So think clearly before communicating to the group. „

Modulate your voice.

„

Listen attentively to others point of view. Not only should you listen to others carefully, it is your duty to show it to others. For example you should not look around when others are making their points, though physically you are listening.

*URXS VNLOOV „ You should be able to gain attention of the group. „

You should be able to draw the non-participants into the discussion.

„

You should be able to state clearly whenever the group agrees on any point, before passing on to the next.

„

Generate a feeling to represent that you are a team player.

„

Display your leadership skills.

„

Towards the end, try to develop a team consensus on the subject and make concluding remarks.

„

If you feel, right in the middle of the discussion, that things are not moving in the right direction, take the initiative to set things right.

Points to note „ In group discussions, it is important not to get agitated even if some one contradicts your argument in an unfair manner. „

There should not be any attempt to sneer at the observations of the team member’s statement

„

A quote from a learned authority on the topic of discussion always provides an edge over others.

68

How to face an Interview Board „

Statistics do add weight-age to one’s observations but these should be quoted only when they are relevant and accurate.

Indicative topics for group discussion 1. Can women be good managers ?  :LOO,QGLDJHWDVHDWDWWKH81VHFXULW\FRXQFLO" 3.

Has WTO been hijacked by the developed countries ?

4.

Nuclear power- a boon or a curse ?

5.

Is administered price mechanism actually dismantled in the oil and gas sector ?

6.

Should all the subsidies be removed ?

7.

Should there be reservation in educational institutions ?

8.

Can anybody predict rise / fall of stock market index predicted ?

9.

Is futures market gambling or a risk management tool ?

 5HVWRULQJWKHVWDNHKROGHUVFRQ¿GHQWLDOLQ¿QDQFLDOVWDWHPHQWV 11. How to deal with international terrorism ?  +RZIULHQGO\DUHZHWRRXUQHLJKERXULQJFRXQWULHV" 13. Corruption is the price we pay for democracy. 14. Foreign TV channels are destroying our culture. 15. How to deal with high oil prices ? 16. Beauty contests degrade womanhood. 17. Should there be private universities ? 19. Should the public sector be privatized ?  ,VJOREDOL]DWLRQUHDOO\QHFHVVDU\"  9DOXHEDVHGSROLWLFVLVWKHQHHGRIWKHKRXU  5HOLJLRQVKRXOGQRWEHPL[HGZLWKSROLWLFV  9LUWXDOOHDUQLQJDVXEVWLWXWHIRUFODVVURRPOHDUQLQJ"  ,PSDFWRIVPDUWSKRQHVRQ\RXQJPLQGV

69

The Institute of Chartered Accountants of India  ,V5(5$D*DPH&KDQJHUIRU,QGLDQ5HDO(VWDWH'HYHORSPHQW"  $UWL¿FLDO,QWHOOLJHQFH:LOOPDQEHHYHUUHSODFHGE\PDFKLQHV"  +RZ*67FDQFKDQJHWKHEXVLQHVVVFHQDULRRI,QGLD"  ,PSDFWRI'HPRQHWL]DWLRQ  6WDUWXS,QGLDDQGLWVLPSDFWRQVWDUWXSFXOWXUHLQ,QGLD  6ZDFKK%KDUDW$EKL\DDQ,VLWMXVWDPRYHPHQWRULVLWWKHFKDQJLQJDWWLWXGHRI people?

³(GXFDWLRQLVERWKDWRRORIVRFLDO MXVWLFHDVZHOODVDIXQGDPHQWDOGULYHURI economic GHYHORSPHQW´ .HYLQ5XGG

³1RWKLQJJUHDWZDVHYHUDFKLHYHG ZLWKRXWHQWKXVLDVP´ 5DOSK:DOGR(PHUVRQ

70

Section IV Facing The Interview In this section... 1.

Preparing Yourself for an Interview

 &RPPRQ,QWHUYLHZ4XHVWLRQV 71

The Institute of Chartered Accountants of India

Preparing Yourself for an Interview %HORZDUHVRPHRIWKHEDVLFUHTXLVLWHVEHIRUHMRELQWHUYLHZV „

Find out about the organization

„

Brush up the details you have mentioned in the resume

„

General awareness

„

Study thoroughly your favourite subjects

„

Have structured answers

On the day of the interview %H SXQFWXDO Leave early to arrive on time. Have ample margin for eventualities such as vehicle EUHDNGRZQVWUDɤFVQDUOVJHWWLQJORVWHWF5HDFKWKHLQWHUYLHZYHQXHDWOHDVW PLQXWHVLQDGYDQFHVRWKDW\RXDUHZHOOVHWWOHGWRIDFHWKHLQWHUYLHZEHIRUH\RXVHWRɣ PDNHVXUH\RXKDYH „

Directions to the location of the interview venue well in advance of the interview time.

„ ,PSRUWDQWFHUWL¿FDWHVWRVHUYHDVGRFXPHQWHGSURRIIRUDOOWKHLQIRUPDWLRQJLYHQ in the resume. „

Stationery, envelops, stamps and stapler.

„ $ FRS\ RI WKH GD\¶V QHZVSDSHU \RX FRXOG UHDG LW RQ WKH ZD\ WR UHOLHYH \RXU tension. Also, you could be asked some questions from the same. „

Enough cash and loose change so that you do not waste time trying to get change for say ` 500 or ` 100 note to pay for transport.

„

An umbrella, especially during the monsoon season else you could get yourself and \RXURULJLQDOFHUWL¿FDWHVGUHQFKHG

„

Carry notes on your objectives in life, your skill sets, your strengths and weaknesses.

72

How to face an Interview Board Before the interview Knock at the door gently before entering the interview room. On entering, smile at each of the interview panel members and greet the time of the day, softly. Wait standing straight, with arms resting easily and sit only after being asked to. After being asked to sit, draw the chair gently and swiftly and sit setting into a convenient posture. Avoid making creaking noise by dragging the chair or by violently ÀRSSLQJLQWRWKHFKDLU6LWFRPIRUWDEOHEXWHUHFW Maintain eye contact with each of the interview panel members, but avoid looking GH¿DQWO\,WLVRNWREHQGIRUZDUGEXWLIWKHUHLVDWDEOHLQIURQW\RXVKRXOGQRWSXW the elbows/hands on the table. Remember, all your actions and body language are observed by the interviewer. It is HVVHQWLDOWKDWWKH¿UVWLPSUHVVLRQ\RXPDNHRI\RXUVHOILVDYHU\JRRGLPSUHVVLRQ During the interview „ If a panel of members conducts the interview, it is advisable to look at all the persons while answering and not only at the person who has asked the question. If a member of the panel interrupts while answering a question of some other members, it is advisable to politely ask him to hold on till the current answer is completed. „

Maintain very comfortable poise throughout the interview by maintaining interest and eye contacts even if you feel that you may not be selected. Keep a smiling IDFHDQGVKRZKLJKOHYHORIFRQ¿GHQFHZKLOH\RXVSHDN0DLQWDLQWKHGLɣHUHQFH EHWZHHQFRQ¿GHQFHDQGDUURJDQFH

„

If you have not heard a question properly or understood it clearly, you can request the interviewer to repeat the question rather than answer a question heard/ understood wrongly.

„

There is nothing wrong in admitting that you do not know the answer to a TXHVWLRQUDWKHUWKDQWU\LQJWRFRQIXVHEOXɣDQGJLYHDORQJZLQGLQJDQVZHU

„

Keep ready extra copies of your resume and testimonials-the same may be required during the interview. Unless specifically asked, do not volunteer to show your WHVWLPRQLDOVRUDFKLHYHPHQWFHUWL¿FDWHV

„ 'RQRWORRNQHUYRXVRURYHUFRQ¿GHQW'RQRWVKRZWRRPXFKQHHGRUDQ[LHW\ to get the job and at the same time do not give the impression that you are not interested in the job. „

Complete your sentences rather than leaving them incomplete and do not use only yes or no or shake your head by way of approval or disapproval. 73

The Institute of Chartered Accountants of India „

If for any reason, the interview is halted in between, do not start wandering around or start reading whatever is lying in front of you. Also do not show your displeasure if the interruption takes some more time you must trust the judgment of the employer about his priorities. Do not show that you are in a hurry to FRPSOHWHWKHLQWHUYLHZXQOHVVVSHFL¿FDOO\DVNHGWRGRVRRU\RXDUHUHDOO\LQD KXUU\WRFDWFK\RXUWUDLQÀLJKW

„
You should be convincingly able to describe what new improvements were brought DERXWGXULQJWKHDXGLWSHULRGDVDOVRKRZ\RXGHDOWZLWKDQ\³FRQÀLFWVLWXDWLRQ´ which may have arisen.

„

You should reasonably be up to date on the recent changes in the professional world, be it all the new accounting standards, amendment to laws, economic/ ¿QDQFLDOGHYHORSPHQWV¿VFDOFKDQJHVHWF

„

On general topics, you should not worry about correct answers but should answer honestly what you feel. You should not be afraid of giving controversial answers as long as you have the logic to support them. Never give answers which you think the interviewer wants to hear.

„ $Q\JDSVLQWKHFDUHHUVKRXOGEHFRQ¿GHQWO\SUHVHQWHGZLWKRXWIHHOLQJGHIHQVLYH emphasizing how you utilized the period constructively. If you did not clear an H[DPLQWKH¿UVWDWWHPSWGRQRWIHHOGHIHQVLYHRUWU\WRKLGHWKHIDFW Avoid the following during the interview „ Frequently shifting your positions in the chair. „

Blinking.

„

Scratching.

„

Stretching.

„

Yawning/burping.

„

Giggling.

„

Cracking knuckles.

„

Fiddling with a pen or mobile.

„

Answering in tense undertones or in a shrill voice.

74

How to face an Interview Board „

Avoid asking pointed question on the salary. However on being asked for salary expectations you should give a broad range, commensurate with relative market worth vis-à-vis the industry you are desirous of joining.

At the end of interview At the end of the interview, the interviewee is usually asked if he has any questions to WKHSDQHO6RPHRIWKHTXHVWLRQVWREHDVNHGDUH (Candidates are also advised to refer to the presentations of the companies. Information already available should not be asked.) „ ([DFWSUR¿OHEHLQJORRNHGIRU „

More details about the organization.

„

Location of posting.

„ ,IWKHUHLVDSUREDWLRQRULIRQHZRXOGEHFRQ¿UPHGLPPHGLDWHO\ „

If there is a formal induction programme planned.

„

When and how would the result be conveyed ?

„

Enquire about reimbursement of train or air fare if not already committed.

At the end of the interview if the panel has nothing more to ask, you should usually conclude by thanking the panel for giving opportunity for being interviewed.
Decide on the travel date, time and mode, giving a clear margin for any delays etc.

„

Reserve if possible in advance for a hotel stay room preferably near the interview location.

„

Wear separate clothes during outstation travel and at the time of Interview.

„

Locate the local overnight or one hour dry cleaner.

„ .HHSVXɤFLHQWPRQH\ZLWK\RXIRUDQ\SURORQJHGVWD\IRULQWHUYLHZDVVRPHWLPHV companies conduct more than one round of interview and keep the other rounds on subsequent days. 75

The Institute of Chartered Accountants of India

What the Interviewer checks in an Interviewee? 1.

Does the interviewee communicate in open, candid, clear, complete and consistent manner?

 :KHWKHUWKHLQWHUYLHZHHKDVGHYHORSHGDQGFRPPXQLFDWHGDFOHDUVLPSOHDQG user focused vision? 3.

Whether the interviewee has futuristic outlook, stretches horizons, challenges and visions?

4.

Whether the interviewee can inspire and energize others & make them commit to a vision?

 :KHWKHUWKHLQWHUYLHZHHFDQXSGDWHKLVYLVLRQWRUHÀHFWFRQVWDQWDQGDFFHOHUDWLQJ change impacting the business? 6.

Does the interviewee inspire & demonstrate a passion for excellence in every aspect of work?

7.

Is the interviewee quality conscious?

8.

Whether the interviewee is willing to make commitments and assume responsibility for mistakes and shortcomings?

9.

Does the interviewee practice ethical conduct?

10. Is there credibility between his/her actions/behaviour with words? 11. Whether the interviewee has the ability to demonstrate courage/confidence to stand for his/her beliefs and ideas?  'RHVWKHLQWHUYLHZHHFDUHIRUUHODWLRQVKLSVZKLOHPDNLQJGLɤFXOWGHFLVLRQV"  'RHVWKHLQWHUYLHZHHOLVWHQHɣHFWLYHO\DQGFRQVWDQWO\SUREHIRUQHZLGHDV" 14. Does the interviewee use facts & rational arguments to persuade others? 15. Can the interviewee form teams across multiple functions and layers? 16. Does the interviewee encourage & promote shared ownership for team vision and goals? 17. Whether the interviewee has the potential to spot talent in other people; provide coaching and feedback to develop team members to their fullest potential? 76

How to face an Interview Board 18. Does the interviewee possess knowledge & intellect to handle the job?  'RHVWKHLQWHUYLHZHHGHOHJDWHWDVNVHPSRZHUVWHDPWRPD[LPL]HHɣHFWLYHQHVV"  &DQWKHLQWHUYLHZHHIXOO\XWLOL]HGLYHUVLW\RIWHDPPHPEHUVFXOWXUDOUDFHJHQGHU  to achieve success?  ,VWKHLQWHUYLHZHHDJRRGDQGDIDVWOHDUQHU"  &DQWKHLQWHUYLHZHHPDNHJRRGGHFLVLRQVZLWKOLPLWHGGDWD"  &DQWKHLQWHUYLHZHHVLPSOLI\FRPSOH[LVVXHVDQGLQLWLDWHDFWLRQ"  &DQWKHLQWHUYLHZHHDQWLFLSDWHSUREOHPVDQGLQLWLDWHLQQRYDWLYHZD\VWRVROYH them?  'RHVWKHLQWHUYLHZHHWUHDWRWKHUVZLWKGLJQLW\WUXVWDQGUHVSHFW"  :KHWKHUWKHLQWHUYLHZHHSRVVHVVHVWKHHQWUHSUHQHXULDOVNLOOVDQGKDVZLOOLQJQHVV to work like an entrepreneur.  :KHWKHUWKHLQWHUYLHZHHKDVVXIILFLHQWOHYHORI,QWHOOHFWXDO4XRWLHQW,4 DQG Emotional Quotient (EQ) like pressure handling skills. 30. Whether the interviewee has the ability to act both as a good team leader as well as a good team member.

77

The Institute of Chartered Accountants of India

Common Interview Questions Companies are looking forward to hire the right talent. It is important for them to know if a candidate will be a team player, a good leader and an enthusiast. The answers given below are in the forms of hints just to provide general idea to the candidates about how to approach an interview. The candidates should give original answers based on their own experiences. PERSONAL QUESTIONS 1. What are your strengths? 'HVFULEH\RXUVWUHQJWKVWKDWPDWFKWKHMRESUR¿OHEHLQJRɣHUHGWR\RX(PSKDVL]HXS on your practical strengths, experience and reliability in the tasks undertaken. Narrate a few incidents where you have demonstrated these qualities. Inform the panel that \RXKDYHFRPSOHWHGWKHWDVNVHɤFLHQWO\ „

Before facing an interview the candidates must be mentally prepared with a list of strengths they possess.

„

A few traits that an employer would seek in their employees are loyalty, integrity, KDUGZRUNLQJSRVLWLYHDWWLWXGHJRRGFRPPXQLFDWLRQVNLOOVGHGLFDWLRQFRQ¿GHQFH punctuality, determination, ability to prioritize etc.

2. What are your weaknesses? Try to turn negatives into positives i.e., present a strength of yours disguised as a ZHDNQHVV7KHLQWHUYLHZHULVQRWLQWHUHVWHGWRNQRZ\RXUSHUVRQDOGH¿FLHQFLHVLQVWHDG concentrate on professional traits that you are developing. )RUH[DPSOH,DPWRRIRFXVHGRQZRUNDQGQHHGWRGHYHORSVRPHDIWHURɤFHKRXUV hobbies. Or I have to work on having more patience and giving myself a break because I always want everything to be done at once. 3. Why should we hire you? Mention your skills and experience and elaborate that you are the best suitable FDQGLGDWHIRUWKHSUR¿OHWKH\DUHRɣHULQJ7HOOWKHPKRZEHQH¿FLDO\RXDUHIRUWKH overall development of their company. Elaborate on your past experiences where you have proved yourself as an asset to the company. „

78

Try and uncover what the employer actually requires, this will help you understand what is he actually looking for and you can mould your answers accordingly.

How to face an Interview Board 4. What are your short term goals ? Highlight what you want to achieve in the next three to five years in terms of responsibility, personal growth and professional acumen. Job seeker should demonstrate clear purpose, enthusiasm and commitment to own goals, plans ahead, do they see the company intervened with their short term goals. „

Never simply state your short term goal but move a step further by stating the steps you are taking to achieve them

)RUH[DPSOH,ZDQWDJRRGVWDUWLQDFRPSDQ\OLNH\RXUVDQGWKRVHUHVSRQVLELOLWLHVDQG roles which will use and improve my skills and capabilities. I want to work with a great energy and enthusiasm for the growth of both my career as well as the organization. 5. Tell me about yourself A good answer to this question focuses on work-related skills and accomplishments. Tell the interviewer why you think your work-related skills and accomplishments would be an asset to the company. You could describe your education and work history (be brief) and then mention one or two personal character traits and tell the interviewer how the traits helped you accomplish a task at work. Do not describe yourself with tired old clichés such as “I’m a team player,” “I have excellent communication skills,” unless you can prove it with an illustration. For H[DPSOHRQHPLJKWVD\³,ZRXOGGHVFULEHP\VHOIDVDVHOIVWDUWHU$W;<=&RUSRUDWLRQ there was a problem with materials management so I created a new inventory system (give details) that reduced expenses by 30 per cent.” 6. According to you, what is your USP? Talk about your skills and experience - why do they make you unique? This answer ZLOOPDNHWKHLQWHUYLHZHUDVVHVV\RXUVNLOOVDQGWUDLWVPHQWLRQVSHFL¿FVNLOOV³:LWKD FRPELQDWLRQRI¿QDQFLDODFXPHQDQGWKHDELOLW\WRGHYHORSUHODWLRQVKLSVZLWKFOLHQWV I am able to use my knowledge to provide information that is user friendly. „ 2QH PXVW WU\ WR DYRLG FRQYHQWLRQDO DQVZHUV VXFK DV ³,¶OO JLYH  WR WKLV position” or “I’m a workaholic.” Interviewers have heard such answers a number RIWLPHVDQGWKHVHDQVZHUVVRXQGVWHUHRW\SLFDODQGDUWL¿FLDO 7. Can you tell me about a problem you have dealt with? Give an example of a practical problem that you faced by including the following points LQ\RXUDQVZHU
79

The Institute of Chartered Accountants of India 8. What is more important: speed or accuracy? Both are important - you work with speed and accuracy. Mention that you manage your work load so that you can achieve both. Also inform the interviewer that apart from VSHHGDQGDFFXUDF\\RX¿UPO\EHOLHYHLQDVVRFLDWLQJTXDOLW\ZLWK\RXUZRUN 9. How do you update your knowledge? Mention that there are various means with which you are constantly updating your knowledge, such as, reading professional magazines, attending courses and seminars, through interaction with your clients, through professional contacts. 10. What is your way of dealing with challenges? State that challenge stimulates you and gets the best work out of you as you have the will to succeed when facing any challenge. You must mention a few examples of the challenges you have faced and tasted success. 11. Are you able to deal with criticism? Show that you are able to take criticism. State that you are mature to handle constructive criticism as it would only help you to improve your performance. You must give an example of a situation where you learnt something useful. 12. How often are you able to meet the deadlines? You can answer this question by saying that deadlines can be met if jobs and tasks are scheduled properly and you always make a schedule of the tasks to be performed. Say that you would never miss a deadline as it would result in a loss of reputation, loss of a client or even money for the organization. You may give an example where you were able to meet a tight deadline. 13. Are you a leader or a follower? An organization would look for a person with leadership qualities; at the same time it would also look for someone who listens to its clients and be guided by their requirements. “I have leadership qualities- my colleagues would agree with my statement. At times, depending on the circumstances, it pays to be a follower too. One should be versatile.”  :RXOG \RX GH¿QH \RXUVHOI DV DPELWLRXV" Mention the positive qualities of being ambitious - focused, goal oriented, committed. Don’t give the impression of being over competitive. “I have the drive and enthusiasm to achieve what the Company wants me to achieve through my commitment and dedication. I would overcome difficulties as I am very focused in doing what I am expected to do.” 80

How to face an Interview Board 15. Do you ever get angry ? Losing your temper would not get you anywhere - it’s the ugly side of your nature. If you lost your temper with a client you would lose the client. “I rarely lose my temper but would not be able to tolerate injustice just like anyone else. At work, I can’t remember when I actually lost my temper.” JOB RELATED QUESTIONS 16. Why do you want to join us? Specify what excites you about the organization you want to join. Tell them why you wish to work in that sector and what appeals to you about the organization you want WRMRLQEUDQGSURIHVVLRQDOLVPUHSXWDWLRQHWF „

For answering this question, it is advisable to browse through the organisation’s website and gather relevant information regarding its working environment.

17. Why did you leave or are you leaving your job? If you are not employed mention in positive terms the reason for leaving. If you are HPSOR\HGIRFXVRQZKDW\RXZDQWLQ\RXUQH[WMRE,DPORRNLQJIRUDFRPSDQ\ZKLFK is team focused. „

While answering this question, never say anything bad about your previous company, boss, or peers etc. The interviewer may perceive that you might end up saying negative about his company the next time you are looking for a job.

18. What are your salary expectations? 6DODU\VFDOHVGLɣHULQLQGXVWULDOVHFWRUV'RVRPHUHVHDUFKRQWKHLQGXVWU\\RXDUH joining and find out your individual worth before committing an answer, unless of course the employer tells you the range before the interview - then it’s to your advantage! 19. What do you know about this organization? Basic information on the organization, such as, management, products/services, location of unit(s), manpower, profit, corporate social responsibility (if applicable), any well acknowledged recent news item (if applicable), whether a listed company, market cap RUDQ\RWKHUUHOHYDQWLQIRUPDWLRQDERXWWKHRUJDQL]DWLRQPXVWEHRQ\RXU¿QJHUWLSV 'R \RX OLNH \RXU FXUUHQW MRESUR¿OH" $QVZHULQDQDɤUPDWLYHPDQQHUDQGVKRZWKHUHOHYDQFHRI\RXUFXUUHQWDVVLJQPHQW WRWKHQHZMRE\RXDUHDSSO\LQJIRUVWDWH\RXUVSHFL¿FUROHDORQJZLWK\RXUGXWLHV and responsibilities in your current assignment, any particular achievements and 81

The Institute of Chartered Accountants of India UHFRJQLWLRQLQWKHRUJDQL]DWLRQZKHUH\RXDUHSUHVHQWO\HPSOR\HG
How to face an Interview Board OTHER QUESTIONS THAT MAY BE ASKED IN THE INTERVIEW ROUND Answers to the below mentioned questions differ according to a candidate’s own requirement. So, answers should be drafted accordingly. 1.  3. 4.  6. 7. 8. 9. 10. 11.  13. 14. 15. 16.

How will you handle job stress? +RZGR\RXIHHODERXWZRUNLQJRQZHHNHQGV" Are you willing to relocate or travel (if yes, then how much- 50%, 80% or 100%)? May I contact your present employer for reference? :KDW¶VWKHPRVWGLɤFXOWSDUWRIEHLQJD-REWLWOH " What are your professional goals? What according to you is success? Where do you see yourself 5 years down the line? What do you consider as your greatest achievement? What is your philosophy towards work and ethics? Why did you choose this particular career? :KDWDUH\RXUH[SHFWDWLRQVIURPWKLVMRE" Would you agree to put interest of the organization ahead of your personal goals? What are your extra-curricular activities? What are the types of job you like to do and why? What do you think KRAs (Key Result Areas) and ICAs (Individual contribution Areas) should be, if we select you, for the position? 17. What is your family background?  +RZGRHVWKLVDVVLJQPHQW¿WLQ\RXUFDUHHUSODQ" 19. How do you think your skills will be useful in discharge of your duties?  :KDWLV\RXUWRWDOQRWLFHSHULRG",IWKHFDQGLGDWHLVDOUHDG\LQVRPHHPSOR\PHQW the numbers for the answer should be correct, as joining time is dependent on the same). ARTICLESHIP TRAINING 1. Tell us about the work done by you in articleship training.  :KHUHKDYH\RXGRQH\RXUWUDLQLQJIURP":KDWW\SHRIDXGLWVKDYH\RXGHDOW with?  :KDWZHUH\RXUUROHVDQGUHVSRQVLELOLWLHVLQWKH¿UP"  :K\KDYH\RXFKDQJHGWKH¿UP"  :KDWDUHWKHPDMRU¿QGLQJVGXULQJDUWLFOHVKLSDQGKRZKDYH\RXGHDOWZLWKWKH issues? 6. What are the major contributions made by you in the process of audit work? 83

The Institute of Chartered Accountants of India 7. 8.

Any major point which you would like to highlight about your work experience during your training. What role has your articleship played in your growth?

GENERAL TECHNICAL QUESTIONS (SUGGESTED)  :KDWLV;%5/"  ([SODLQ,QYHVWRUV(GXFDWLRQ 3URWHFWLRQ)XQG" 3. What is the importance of CSR in an organization? 4. What do you know about the recent Companies Bill? 5. What is the importance of Credit Rating in today’s Economic scenario; Name a few credit rating agencies in India? 6. How will the FDI in Multi Brand retail impact Indian Counter Part?  :KDWLVWKHFXUUHQW*'3JURZWKUDWHDQGFXUUHQW,QÀDWLRQUDWHLQ,QGLD"  :KDWGR\RXXQGHUVWDQGE\WKHWHUP)LVFDO'H¿FLW" 9. What is the function of SEBI? 10. What is Finance Commission? 11. What is the ongoing repo rate issued by RBI?  :KDWGR\RXXQGHUVWDQGE\&55DQGZKDWLVWKHRQJRLQJ&55" 13. What is RTI? 14. How is GDP and NDP calculated?  +RZLVLQÀDWLRQFDOFXODWHG" 16. What are P-Notes and what has SEBI done to regulate P-Notes? 17. What does Brexit mean? 18. What are Green Bonds and Masala Bonds?  :KDWLV=HUR%DVHG%XGJHWLQJDQGLWVVLJQL¿FDQFH"  :K\WKHWHUPµ)LQDQFLDO6WDELOLW\¶LVDVVXPLQJVLJQL¿FDQFH"  :KDWLV6WDJÀDWLRQ"  :KDWGRHV*67PHDQDQGFRXOGEHLWVLPSOLFDWLRQVRQ,QGLDQHFRQRP\"  :KDW¶VWKHUDWLRQDOHEHKLQGLQWURGXFLQJ&65"  'HVFULEHEULHÀ\DERXW,QVROYHQF\DQG%DQNUXSWF\&RGH"  .H\KLJKOLJKWVRI5HDO(VWDWH5HJXODWLRQDQG'HYHORSPHQW $FW"  :KDWLV'LJLWDO7UDQVIRUPDWLRQ ,QQRYDWLRQ"  :KDWLV%LWFRLQ" 84

Section V Preparing A Resume

85

The Institute of Chartered Accountants of India

Preparing a resume Prospective employers look for the following personality characteristics • Being pleasant. •

Determination.

•

Energy.

•

Team spirit.

•

Enthusiasm.

•

Drive.

Prospective employers look for the following employability skills • Communication skills •

Maintaining personal rapport.

•

Leadership qualities.

•

The will to accept challenges.

•

Adept in solving problems.

•

Exploiting your inner potential.

•

Ability to achieve targets.

•

Maintaining excellent working relationships.

•

Having good analytical abilities.

•

A general awareness of the business environment and its impact on the organization.

The covering letter of a resume A cover letter must always accompany the resume. In the opening paragraph adopt RQHRIWKHIROORZLQJ •

If you have been referred to a prospective employer, mention the contact by name.

•

If you are responding to a job advertisement, do mention where you have learned about the opening.

86

How to face an Interview Board In the next paragraph „ ,I\RXDUHUHVSRQGLQJWRDMRERSHQLQJPHQWLRQ\RXUTXDOL¿FDWLRQVKRZ\RXU skills are transferable and relate to the position applied for. „

If enquiring about a job opening, mention how your skills can meet the Employer’s expectations.

In the concluding paragraph „ Request for an appointment at a mutually convenient time. „

Mention that references can be made available on request.

Writing a resume 5HVXPHLVWKH¿UVWFRQWDFWSRLQWRIWKHFDQGLGDWHVZLWKWKHSURVSHFWLYHHPSOR\HUV It therefore needs to be given at least the same level of importance as the interview itself. This is so because in most cases the questions would relate to or emerge from the resume sent by the candidate. Whatever is mentioned in the details of the job in the advertisement must be covered either in the resume or in the covering letter. It may thus make sense to consider the job requirements of each prospective employer and revise the resume to suit the requirements. Thus writing resume need not be and VKRXOGQRWEHWKHRQHWKDW¿WVDOONLQGVRIMREV 

7KHOHQJWKVKRXOGQRWH[FHHGWZRSDJHV,QWKH¿UVWVFUHHQLQJURXQGWKH5HVXPH gets scrutinized in a few minutes. Therefore, a good presentation is a must. Remember that your resume is not your biography and hence only relevant and material information should be furnished.

 &KHFNIRUJUDPPDWLFDOHUURUVDQGPLVWDNHV$VNVRPHRQHWRUHYLHZWKHUHVXPH $SDUWIURPXVLQJVWDQGDUGVSHOOFKHFNIHDWXUHVRIRɤFHVXLWHIXQFWLRQRQHQHHGV to go through each and every word of the resume to see its appropriateness and proper placement. 3.

Emphasize your skills, accomplishments and experience. Wherever you can see the linkage of your skills and achievements with the job, you stand better chances of selection-give it a thought before you list down your skills, achievements and experience details.

4.

Make an honest presentation even if you have been out of employment. Prospective employers verify antecedents.

5.

Make a presentation in the skills oriented format if you are unemployed. For those in employment, the chronological format will be relevant.

87

The Institute of Chartered Accountants of India 6.

Try and use key words and phrases as stated in the advertisement, which match the position applied for.

 'RQ¶WUHVSRQGWRHYHU\DGYHUWLVHPHQWWKDW\RXVHH,I\RXDUHQRWTXDOL¿HGIRUWKH position, do not apply. 8.

Do not attach testimonials. These must be carried to the interview.

9.

Short sentences with bullets create a better impact. Avoid lengthy Paragraphs.

10. Follow the same style of numbers and bullets throughout the resume so that you are methodological in your approach to everything. 11. As it is said, in the resume talk about your career journey and not your carrier journey. Always 1. Print your resume on standard letter size, white or ivory rag paper.  +DYH WKH UHVXPH SURIHVVLRQDOO\ W\SHG EXW QRW W\SHVHW ZLWK SOHQW\ RI VSDFH between paragraphs, and allow for adequate margins. 3.

Use conventional English. Stay away from a multi-syllable word when a one or two syllable word is clearer. Understand that resume is not a test of English language DQGWKXVXVLQJYHU\ÀRZHU\DQGRUQDPHQWDOODQJXDJHVKRXOGEHDYRLGHG

 8VHVKRUWSDUDJUDSKVSUHIHUDEO\QRWORQJHUWKDQ¿YHOLQHV 5.

Make sure the resume and the cover letter are error-free, proofread.

 5HZULWHDUHVXPHIRUDVSHFL¿FFRPSDQ\LW¶VH[WUDZRUNEXWPD\ZHOOSD\Rɣ  ,QFOXGH\RXUVLJQL¿FDQWFRQWULEXWLRQVDWHDFKRQHRI\RXUMREV 8.

Allow the most space to the jobs that are most relevant to the job you’re applying for.

9.

List your activity with professional, trade and civic associations-but only If they’re appropriate.

 .HHSDSHUPDQHQW¿OHRI\RXUDFKLHYHPHQWVQRPDWWHUKRZLQFRQVHTXHQWLDOWKH\ may appear to be. This is the basis for a good resume, and it is also essential information to get a raise or promotion. 11. Give each of your reference a copy of your resume.  5HUHDG\RXUUHVXPHEHIRUHWKHLQWHUYLHZ&KDQFHVDUHWKHLQWHUYLHZHUGLGMXVW that too. 88

How to face an Interview Board Never 1. Give reasons for termination or leaving a job on the resume. In almost all cases, WKHUHDGHUFDQ¿QGQHJDWLYHFRQQRWDWLRQVWRHYHQWKHEHVWUHDVRQ
List references on the resume.

 8VHH[DFWGDWHV0RQWKVDQG\HDUVDUHVXɤFLHQW 5.

Include the date your resume was prepared. If your search takes longer than a few months, the resume will appear outdated.

6.

State your company’s phone number.

7.

Include your height, weight or remarks about your physical appearance or health.

8.

State your objectives in your resume unless the resume is targeted to that job or occupation.

9.

Use professional jargon unless you’re sure the resume will be read by someone who understands the buzz-words.

10. Do not provide salary information on the resume. Save it for interview. If you are required to give that information, reveal it in the cover letter. 11. Do not exaggerate your skills beyond reasonableness. After sending your resume, it will be a better idea to follow-up over phone regarding its receipt with relevant organization. An example This is (name of the candidate) calling. A few days ago, I had applied for the (position) in your organization (dept./division). I would like to ascertain whether you have received my resume and to reiterate my interest to the position.

89

The Institute of Chartered Accountants of India Notes ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. .............................................................................................................................................

90

How to face an Interview Board Notes ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. .............................................................................................................................................

91

The Institute of Chartered Accountants of India Notes ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. ............................................................................................................................................. .............................................................................................................................................

92