Protein > Fasta-protein > Aba60377
This document was uploaded by user and they confirmed that they have the permission to share it. If you are author or own the copyright of this book, please report to us by using this DMCA report form. Report DMCA
Overview
Download & View Protein > Fasta-protein > Aba60377 as PDF for free.
More details
- Words: 11
- Pages: 1
>aba60377.1 mx1 [sus scrofa] mvysnceskepdsvsasnhlllngndelvekshktgpennlysqyeekvrpcidlidslralgveqdlal paiavigdqssgkssvlealsgvalprgsgivtrcplvlklkklvneedewkgkvsyrdseielsdasqv ekevsaaqiaiagegvgishelislevssphvpdltlidlpgitrvavgnqpydieyqikslikkyickq etinlvvvpcnvdiattealrmaqevdpegdrtigiltkpdlvdkgtedkivdvarnlvfhlkkgymivk crgqqdiqdqlslakalqkeqaffenhehfrdlleegratipclaerltselimhicetlpllenqikes hqkiteelqkygsdipedesgkmfflideidafnsditaliqgeelvveyecrlftkmrnefckwsavve knfkngydaickqiqlfenqyrgrelpgfvnyktfetiikkqvsvleepavdmlhtvtg
Related Documents
Protein > Fasta-protein > Aba60377
November 2019 5
Protein > Genbank-protein > Aba60377
November 2019 8
Protein
April 2020 26
Protein
November 2019 55
Protein
June 2020 23