Nucl > Genbank-nucl > Ay902746

  • November 2019
  • PDF

This document was uploaded by user and they confirmed that they have the permission to share it. If you are author or own the copyright of this book, please report to us by using this DMCA report form. Report DMCA


Overview

Download & View Nucl > Genbank-nucl > Ay902746 as PDF for free.

More details

  • Words: 281
  • Pages: 2
locus definition

ay902746s1 1135 bp dna linear mam 01-feb-2006 sus scrofa breed large white myxovirus protein gene, exon 7 and partial cds. accession ay902746 version ay902746.1 gi:71041495 keywords . segment 1 of 2 source sus scrofa (pig) organism sus scrofa eukaryota; metazoa; chordata; craniata; vertebrata; euteleostomi; mammalia; eutheria; laurasiatheria; cetartiodactyla; suina; suidae; sus. reference 1 (bases 1 to 1135) authors li,x.l., deng,c.y. and xiong,y.z. title isolation and sequence analysis of the myxovirus journal unpublished reference 2 (bases 1 to 1135) authors li,x.l., deng,c.y. and xiong,y.z. title direct submission journal submitted (10-jan-2005) college of animal science and veterinary medicine, huazhong agricultural university, agricultural ministry key laboratory of swine genetics and breeding, lion mountain street no. 1, wuhan, hubei 430070, china features location/qualifiers source 1..1135 /organism="sus scrofa" /mol_type="genomic dna" /db_xref="taxon:9823" /note="breed: large white" mrna <1001..>1135 /product="myxovirus protein" cds <1001..>1135 /codon_start=1 /product="myxovirus protein" /protein_id="aaz20470.1" /db_xref="gi:71041497" /translation="ikslikkyickqetinlvvvpcnvdiattealrmaqevdpegdr t" exon 1001..>1135 /number=7 origin 1 taggcaatca gccatacgac atcgaatacc aggtgagacc tcgggctcca tcctggcggg 61 ggccttgcgg gggcggggct gcgttacagc aggactgtga gttcaggact gtgtctgaag 121 aatgggtgct aggaggtgtg agtggggatt tggagaacac agaggttgaa attggctcca 181 ccaatgtgga cagaggcaaa tcgaagaagt tggcaatgcc ttttatttgt gttttaggta 241 gtgactcatt ttgtgccata tctaaggtgg tatgtatcag gggagaggtt ttatggggga 301 agagagagca ttagaagcaa gtatagtgat atttctgaat cagtgaatct caccatatgg 361 gaatatacgt gtaattatta ttgtgattgc gggaatatac aagcaattat ttcaacgtct 421 tgtttttcgt tgtgaccatc agatttgagg tcttaggaga gagtgatatc acttctgtct 481 ggaatctaat atatggcaca aaaggaacct ttccacagaa aaagaaaatc atggacttgc 541 agaatagacc tgtggttgcc aaggggaagg gggagggagt ggggtggttg gggagcttgg 601 ggttaataga tgcaaactat tgcctttgga atggatgagc aatgagatcc tgctgtgcag 661 tcctgggaac tgtgtgcagt cacttacgat ggagcatgat tatatgcgaa aatagaatgt 721 gtacatgcat gtgtaactgg gtcaccatgc tgtacagtag aagaaaatat tgtatcgggg 781 agataactat taaaaaataa taattacaaa aagaaatctc atggttttcc ctgatcccag 841 agttagtttc tccggctccg aaagtgctgc caggcttgta ttgcgagctc atttctccgt 901 tgctgcttct ttggagagac tcctctggga cttggagggt ctgaagccag tacaaggtca 961 ggacccgtct cagttctcat gccctctttt cttctaacag atcaagtctc tgatcaagaa

1021 gtacatctgt aagcaggaga ccatcaactt ggtggtggtc ccctgcaacg tggacattgc 1081 caccacggag gcgctgcgca tggcccagga ggtggacccc gaaggagaca ggacc

Related Documents