Nucl > Genbank-nucl > Ay902748

locus definition

ay902746s2 589 bp dna linear mam 01-feb-2006 sus scrofa breed large white myxovirus protein gene, exons 9, 10 and partial cds. accession ay902748 version ay902748.1 gi:71041496 keywords . segment 2 of 2 source sus scrofa (pig) organism sus scrofa eukaryota; metazoa; chordata; craniata; vertebrata; euteleostomi; mammalia; eutheria; laurasiatheria; cetartiodactyla; suina; suidae; sus. reference 1 (bases 1 to 589) authors li,x.l., deng,c.y. and xiong,y.z. title isolation and sequence analysis of the myxovirus journal unpublished reference 2 (bases 1 to 589) authors li,x.l., deng,c.y. and xiong,y.z. title direct submission journal submitted (10-jan-2005) college of animal science and veterinary medicine, huazhong agricultural university, agricultural ministry key laboratory of swine genetics and breeding, lion mountain street no. 1, wuhan, hubei 430070, china features location/qualifiers source 1..589 /organism="sus scrofa" /mol_type="genomic dna" /db_xref="taxon:9823" /note="breed: large white" mrna join(<1..82,497..>589) /product="myxovirus protein" cds join(<1..82,497..>589) /codon_start=2 /product="myxovirus protein" /protein_id="aaz20471.1" /db_xref="gi:71041498" /translation="qkiteelqkygsdipedesgkmfflidkidafnsditaliqgee lvveyecrlftkmr" exon <1..82 /number=9 exon 497..>589 /number=10 origin 1 ccagaaaata acagaggagt tacagaagta tggctccgat attccagagg atgaaagcgg 61 gaagatgttt tttctgatag atgtgagtgc tgccaggggc gccaaggtgg agaagcatcc 121 atcattgtcc agagaggggc catgtgcttt gcacgtgtct cgcttcattc ccctcaggct 181 gatccggact catgctgccc acttagcccc acaaggcggc caggttgggg gctgggtaga 241 cagggagtgg gggaccgtcc cattcacgcc actggctctt catcaagtgc gctcacctga 301 ggccagaagg cagtagggag ggtgggatcg cctgctgcca aagcccctgc tctccctccg 361 gacgcgcacc tgctccccac ccgcaccctg cccattaggc agcagagaag gctcgccagc 421 cctgtctgca ccctctccaa atcacctctt atatttgcaa tatttccgct tatacgaatg 481 tgtttccttt tgacagaaaa tcgatgcatt taatagtgat atcactgctt tgatacaagg 541 agaggaactg gtagtggagt acgagtgtcg gctgtttacc aagatgcga